10JK: Human Argonaute2-miR200b RISC

Structure of Human Argonaute2-miR200b RISC bound to 30nt long target in complex with kinase CK1alpha. Determined by electron microscopy at 2.8 Å resolution. Released 23 Sept 2026.

Method: Electron microscopy
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 9,864
Mol. weight: 152.92 kDa
Ligands: MG
Released: 23 Sept 2026

Explore 10JK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

10JK contains 46 α-helices and 63 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 49 β-strands

Element	Residues	Length	Sheet
α-helix	25-28	4
β-strand	36-42	7	1
β-strand	44-48	5	2
β-strand	53-61	9	3
α-helix	68-81	14
β-strand	93-94	2	3
β-strand	99-102	4	3
β-strand	113-120	8	3
β-strand	125-139	15	3
α-helix	140-148	9
α-helix	156-166	11
α-helix	168-173	6
β-strand	175-177	3	2
β-strand	180-182	3	2
β-strand	191	1	2
β-strand	196-208	13	2
β-strand	213-225	13	2
β-strand	229	1	4
α-helix	230-238	9
α-helix	243-245	3
α-helix	249-251	3
α-helix	252-262	11
β-strand	266-269	4	4
β-strand	278-280	3	4
β-strand	281-284	4	5
β-strand	293-295	3	6
α-helix	303-304	2
β-strand	305-307	3	6
α-helix	308-314	7
β-strand	327-330	4	5
β-strand	337-340	4	5
α-helix	341-343	3
β-strand	344-346	3	4
β-strand	351	1	2
α-helix	358-367	10
α-helix	372-386	15
α-helix	388-390	3
α-helix	392-397	6
β-strand	400-401	2	2
β-strand	407-412	6	1
α-helix	413-415	3
β-strand	418-419	2	7
β-strand	427-428	2	7
β-strand	431	1	8
β-strand	434	1	8
β-strand	444	1	9
β-strand	448	1	10
β-strand	451-455	5	11
α-helix	464-481	18
β-strand	485	1	10
β-strand	492-494	3	11
α-helix	498-500	3
α-helix	501-511	11
β-strand	517-522	6	11
α-helix	528-535	8
α-helix	536-540	5
β-strand	544-548	5	11
α-helix	549-553	5
α-helix	557-571	15
β-strand	574	1	9
β-strand	577-578	2	7
α-helix	585-588	4
β-strand	591-599	9	1
β-strand	610-617	8	1
β-strand	625-632	8	1
α-helix	642-657	16
β-strand	663-669	7	1
α-helix	673-675	3
α-helix	676-694	19
β-strand	701-708	8	1
β-strand	715-717	3	1
β-strand	724	1	12
β-strand	729	1	12
α-helix	730-731	2
β-strand	734-736	3	1
β-strand	747-751	5	1
β-strand	763-770	8	1
α-helix	776-786	11
β-strand	795	1	8
α-helix	801-817	17
α-helix	839-845	7

Chain B: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	13
β-strand	17-24	8	13
β-strand	30-36	7	13
β-strand	41-49	9	13
α-helix	56-67	12
α-helix	74-76	3
β-strand	78	1	13
β-strand	82	1	13
β-strand	85-90	6	13
β-strand	96	1	14
α-helix	97-103	7
α-helix	112-129	18
β-strand	133	1	15
α-helix	139-141	3
β-strand	142-144	3	14
β-strand	153-155	3	14
β-strand	162	1	15
β-strand	165	1	16
β-strand	172	1	16
α-helix	173-175	3
α-helix	190-194	5
α-helix	196-198	3
α-helix	200-216	17
α-helix	229-242	14
α-helix	245-248	4
α-helix	254-264	11
α-helix	274-287	14
α-helix	297-302	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein argonaute-2	A	protein	860	Homo sapiens	Q9UKV8 (AlphaFold model)
Casein kinase I isoform alpha	B	protein	337	Homo sapiens	P48729 (AlphaFold model)
RNA (5'-r(pupapapupapcpupgpcpcpupgpgpupapapupgpapupgpa)-3')	C	RNA	22	Homo sapiens
30-nt target RNA	D	RNA	30	Homo sapiens

Sequence of entity 1 (A), FASTA

>10JK_1 Protein argonaute-2 (chains A)
AMYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYEL
DIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTL
PGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGR
SFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLD
FKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQE
SGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDN
QTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSIL
YGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISR
DAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTV
LGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVT
HPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRF
KPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTD
KNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDEL
QILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDH
QALAKAVQVHQDTLRTMYFA

Sequence of entity 2 (B), FASTA

>10JK_2 Casein kinase I isoform alpha (chains B)
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF

Sequence of entity 3 (C), FASTA

>10JK_3 RNA (5'-R(P*UP*AP*AP*UP*AP*CP*UP*GP*CP*CP*UP*GP*GP*UP*AP*AP*UP*GP*AP*UP*GP*A)-3') (chains C)
UAAUACUGCCUGGUAAUGAUGA

Sequence of entity 4 (D), FASTA

>10JK_4 30-nt target RNA (chains D)
ACAUUAGCUGAUUUUUACCUAUCAGUAUUA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Structure of Human Argonaute2-miR200b RISC bound to 30nt long target in complex with kinase CK1alpha. Garg, A., Joshua-Tor, L. To be published.

Other PDB entries of the same protein (UniProt Q9UKV8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9BF2 1.59 Å, MID domain of Ago2 bound to UMP
4Z4D 1.6 Å, Human Argonaute2 Bound to t1-G Target RNA
3LUC 1.69 Å, Crystal structure of MID domain from hAGO2
3LUK 1.7 Å, Crystal structure of MID domain from hAGO2
7C6B 1.7 Å, Crystal structure of Ago2 MID domain in complex with 6-(3-(2-carboxyethyl)phenyl)purine…
9LSN 1.75 Å, hAGO2-MID in complex with a chemical modified uridine monophosphate
9BF0 1.78 Å, MID domain of human Argo2 bound to UTP
3LUJ 1.8 Å, Crystal structure of MID domain from hAGO2 in complex with UMP
4Z4E 1.8 Å, Human Argonaute2 Bound to t1-U Target RNA
9LMZ 1.8 Å, hAGO2-MID in complex with a chemical modified uridine monophosphate
4W5O 1.8 Å, The Crystal Structure of Human Argonaute2 Bound to a Guide and Target RNA Containing…
3LUG 1.85 Å, Crystal structure of MID domain from hAGO2 in complex with CMP

Browse structure collections

About this viewer

MolViewer shows 10JK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.