13LU: PDB entry 13LU

Structure of human TRPV3-W521S Olmsted syndrome mutant in the closed state. Determined by electron microscopy at 2.49 Å resolution. Released 1 Jul 2026.

Method: Electron microscopy
Resolution: 2.49 Å
Organisms: Homo sapiens, Aequorea victoria
Chains: 4
Atoms: 22,137
Mol. weight: 504.57 kDa
Ligands: POV
Released: 1 Jul 2026

Explore 13LU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

13LU contains 144 α-helices and 40 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 36 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	120-129	10
α-helix	132-144	13
α-helix	151-153	3
α-helix	154-158	5
β-strand	163	1	1
β-strand	170	1	1
α-helix	171-176	6
α-helix	183-195	13
α-helix	200-204	5
β-strand	208	1	2
β-strand	214	1	2
α-helix	218-224	7
α-helix	228-235	8
α-helix	265-271	7
α-helix	275-282	8
α-helix	299-306	8
α-helix	316-328	13
α-helix	332-335	4
α-helix	344-350	7
α-helix	354-361	8
α-helix	371-373	3
β-strand	376-382	7	3
β-strand	385-391	7	3
α-helix	403-408	6
α-helix	416-419	4
α-helix	423-432	10
α-helix	433-437	5
α-helix	438-460	23
α-helix	481-506	26
α-helix	522-541	20
α-helix	547-560	14
α-helix	561-568	8
α-helix	570-582	13
α-helix	583-587	5
α-helix	588-606	19
β-strand	609	1	4
α-helix	610-613	4
α-helix	625-637	13
β-strand	648	1	4
α-helix	651-662	12
α-helix	663-669	7
α-helix	670-684	15
α-helix	688-704	17
α-helix	709-712	4
β-strand	719-724	6	3
β-strand	727-737	11	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent…	A, B, C, D	protein	1052	Homo sapiens, Aequorea victoria	P42212 (AlphaFold model), Q8NET8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>13LU_1 Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A, B, C, D)
MKAHPKEMVPLMGKRVAAPSGNPAILPEKRPAEITPTKKSAHFFLEIEGFEPNPTVAKTS
PPVFSKPMDSNIRQCISGNCDDMDSPQSPQDDVTETPSNPNSPSAQLAKEEQRRKKRRLK
KRIFAAVSEGCVEELVELLVELQELCRRRHDEDVPDFLMHKLTASDTGKTCLMKALLNIN
PNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTALNIAIERRQGDIAALLIAAGAD
VNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNIL
HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYI
LSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEML
TLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMG
WLQLLGRMFVLIWAMCISVKEGIAIFLLRPSDLQSILSDASFHFVFFIQAVLVILSVFLY
LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLG
FGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLIT
YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL
CKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTADFNKIQDSSRNNSKTTLNAF
EEVEEFPETSVLVPRGSAAAAVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY
GKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF
FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKN
GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMV
LLEFVTAAGITLGMDELYKSGLRSWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	32

Water and common crystallization additives (NA) are not listed.

Primary citation

Structural diversity of heat-sensing channel TRPV3 with Olmsted syndrome mutations. Khau, J., Purohit, R., Nadezhdin, K.D. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-74687-5 · PubMed

Other PDB entries of the same protein (UniProt P42212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L27 0.77 Å, X-ray crystal structure of the mutant green fluorescent protein
6JGJ 0.78 Å, Crystal structure of the F99S/M153T/V163A/E222Q variant of GFP at 0.78 A
6KL0 0.8 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 7.0
6JGI 0.85 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of GFP at 0.85 A
6KL1 0.85 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of non-deuterated GFP at pD 8.5
2WUR 0.9 Å, Atomic resolution structure of GFP measured on a rotating anode
6KKZ 0.9 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 8.5
6JGH 0.94 Å, Crystal structure of the F99S/M153T/V163A/T203I variant of GFP at 0.94 A
4AS8 1.02 Å, X-ray structure of the cyan fluorescent protein Cerulean cryoprotected with ethylene…
5OXC 1.02 Å, Structure of Cerulean Fluorescent Protein at 1.02 Angstrom resolution
7PCA 1.05 Å, Functional and structural characterization of redox sensitive superfolder green…
4GF6 1.1 Å, crystal structure of GFP with cuprum bound at the Incorporated metal Chelating Amino…

Browse structure collections

About this viewer

MolViewer shows 13LU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.