PanDDA analysis group deposition -- IDOL RING domain in complex with Z275179946. Determined by X-ray diffraction at 1.4 Å resolution. Released 10 Dec 2025.
Explore 13SM in 3D Show helices and sheets RCSB PDB PDBe
13SM contains 8 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 369-383 | 15 | |
| β-strand | 386 | 1 | 1 |
| β-strand | 394 | 1 | 1 |
| β-strand | 397-400 | 4 | 2 |
| β-strand | 404 | 1 | 3 |
| β-strand | 407 | 1 | 2 |
| α-helix | 409-412 | 4 | |
| β-strand | 417 | 1 | 4 |
| β-strand | 424 | 1 | 4 |
| β-strand | 427-430 | 4 | 2 |
| β-strand | 432 | 1 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 369-384 | 16 | |
| β-strand | 386 | 1 | 6 |
| β-strand | 394 | 1 | 6 |
| β-strand | 397-400 | 4 | 7 |
| β-strand | 404 | 1 | 5 |
| β-strand | 407 | 1 | 7 |
| α-helix | 409-413 | 5 | |
| β-strand | 417 | 1 | 8 |
| β-strand | 424 | 1 | 8 |
| β-strand | 427-430 | 4 | 7 |
| β-strand | 432 | 1 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 369-384 | 16 | |
| β-strand | 386 | 1 | 14 |
| β-strand | 394 | 1 | 14 |
| β-strand | 397-400 | 4 | 15 |
| β-strand | 404 | 1 | 13 |
| β-strand | 407 | 1 | 15 |
| α-helix | 409-412 | 4 | |
| β-strand | 417 | 1 | 16 |
| β-strand | 424 | 1 | 16 |
| β-strand | 427-430 | 4 | 15 |
| β-strand | 432 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase MYLIP | A, B, C, D | protein | 78 | Homo sapiens | Q8WY64 (AlphaFold model) |
>13SM_1 E3 ubiquitin-protein ligase MYLIP (chains A, B, C, D) SQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEH VQHVYLPTHTSLLNLTVI
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 8 |
| GW1 | (4-chloranyl-2-methyl-pyrazol-3-yl)-piperidin-1-yl-methanone | C10 H14 Cl N3 O | 2 |
PanDDA analysis group deposition. Bradshaw, W.J., Guenther, F., Murphy, E.J. To be published.
Other PDB entries of the same protein (UniProt Q8WY64 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 13SM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.