1A0A: Protein

Phosphate system positive regulatory protein PHO4/DNA complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 18 Mar 1998.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 1,767
Mol. weight: 24.62 kDa
Released: 18 Mar 1998

Explore 1A0A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A0A contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	4-8	5
α-helix	10-25	16
α-helix	29-32	4
α-helix	36-37	2
α-helix	44-57	14

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-24	23
α-helix	30-32	3
α-helix	43-56	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(cptpcpapcpapcpgptpgpgpgpapcptpap*g )-3')	C	DNA	17
DNA (5'-d(cptpapgptpcpcpcpapcpgptpgptpgpap*g )-3')	D	DNA	17
Protein (phosphate system positive regulatory protein PHO4)	A, B	protein	63	Saccharomyces cerevisiae	P07270 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1A0A_1 DNA (5'-D(*CP*TP*CP*AP*CP*AP*CP*GP*TP*GP*GP*GP*AP*CP*TP*AP*G )-3') (chains C)
CTCACACGTGGGACTAG

Sequence of entity 2 (D), FASTA

>1A0A_2 DNA (5'-D(*CP*TP*AP*GP*TP*CP*CP*CP*AP*CP*GP*TP*GP*TP*GP*AP*G )-3') (chains D)
CTAGTCCCACGTGTGAG

Sequence of entity 3 (A, B), FASTA

>1A0A_3 PROTEIN (PHOSPHATE SYSTEM POSITIVE REGULATORY PROTEIN PHO4) (chains A, B)
MKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQN
GST

Primary citation

Crystal structure of PHO4 bHLH domain-DNA complex: flanking base recognition. Shimizu, T., Toumoto, A., Ihara, K. et al. EMBO J (1997) 16:4689-4697. DOI 10.1093/emboj/16.15.4689 · PubMed

Other PDB entries of the same protein (UniProt P07270 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3W3X 2.9 Å, Crystal structure of Kap121p bound to Pho4p
9D45 3.1 Å, Cryo-EM structure of yeast Exportin Msn5 bound to cargo Pho4 and RanGTP

Browse structure collections

About this viewer

MolViewer shows 1A0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.