Influenza virus B/BEIJING/1/87 neuraminidase complexed with zanamivir. Determined by X-ray diffraction at 2.2 Å resolution. Released 2 Mar 1999.
Explore 1A4G in 3D Show helices and sheets RCSB PDB PDBe
1A4G contains 12 α-helices and 66 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 77-80 | 4 | |
| α-helix | 84 | 1 | |
| β-strand | 85 | 1 | 1 |
| α-helix | 86 | 1 | |
| β-strand | 91-97 | 7 | 1 |
| α-helix | 99-102 | 4 | |
| β-strand | 111 | 1 | 2 |
| β-strand | 112-121 | 10 | 3 |
| β-strand | 126-136 | 11 | 3 |
| β-strand | 154-159 | 6 | 3 |
| β-strand | 160 | 1 | 4 |
| β-strand | 162 | 1 | 4 |
| β-strand | 165 | 1 | 2 |
| β-strand | 170-174 | 5 | 3 |
| β-strand | 178-182 | 5 | 5 |
| β-strand | 187-193 | 7 | 5 |
| β-strand | 200-205 | 6 | 5 |
| β-strand | 208-214 | 7 | 5 |
| β-strand | 222-223 | 2 | 6 |
| β-strand | 229-231 | 3 | 6 |
| β-strand | 234-240 | 7 | 6 |
| β-strand | 242 | 1 | 7 |
| β-strand | 248 | 1 | 7 |
| β-strand | 251-256 | 6 | 6 |
| β-strand | 259-264 | 6 | 6 |
| β-strand | 267-268 | 2 | 8 |
| β-strand | 272 | 1 | 7 |
| β-strand | 274-280 | 7 | 8 |
| β-strand | 285-291 | 7 | 8 |
| α-helix | 299 | 1 | |
| β-strand | 300-305 | 6 | 8 |
| β-strand | 310-315 | 6 | 8 |
| β-strand | 351-355 | 5 | 9 |
| β-strand | 360-366 | 7 | 9 |
| β-strand | 374-382 | 9 | 9 |
| α-helix | 391-393 | 3 | |
| β-strand | 394-405 | 12 | 9 |
| β-strand | 409-415 | 7 | 1 |
| β-strand | 420-430 | 11 | 1 |
| β-strand | 439-447 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 84 | 1 | |
| β-strand | 85 | 1 | 10 |
| α-helix | 86 | 1 | |
| β-strand | 91-97 | 7 | 10 |
| α-helix | 99-102 | 4 | |
| β-strand | 111 | 1 | 11 |
| β-strand | 112-121 | 10 | 12 |
| β-strand | 126-136 | 11 | 12 |
| β-strand | 154-159 | 6 | 12 |
| β-strand | 165 | 1 | 11 |
| β-strand | 170-174 | 5 | 12 |
| β-strand | 177-182 | 6 | 13 |
| β-strand | 187-193 | 7 | 13 |
| α-helix | 196-198 | 3 | |
| β-strand | 200-205 | 6 | 13 |
| β-strand | 208-214 | 7 | 13 |
| β-strand | 222-223 | 2 | 14 |
| β-strand | 229-231 | 3 | 14 |
| β-strand | 234-240 | 7 | 14 |
| β-strand | 242 | 1 | 15 |
| β-strand | 248 | 1 | 15 |
| β-strand | 251-256 | 6 | 14 |
| β-strand | 259-264 | 6 | 14 |
| β-strand | 267-268 | 2 | 16 |
| β-strand | 272 | 1 | 15 |
| β-strand | 274-280 | 7 | 16 |
| β-strand | 285-291 | 7 | 16 |
| α-helix | 299 | 1 | |
| β-strand | 300-305 | 6 | 16 |
| β-strand | 310-315 | 6 | 16 |
| β-strand | 351-355 | 5 | 17 |
| β-strand | 360-366 | 7 | 17 |
| β-strand | 374-382 | 9 | 17 |
| α-helix | 392-393 | 2 | |
| β-strand | 394-405 | 12 | 17 |
| β-strand | 409-415 | 7 | 10 |
| β-strand | 420-430 | 11 | 10 |
| β-strand | 439-447 | 9 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neuraminidase | A, B | protein | 390 | Influenza B virus (STRAIN B/BEIJING/1/87) | P27907 |
>1A4G_1 NEURAMINIDASE (chains A, B) EPEWTYPRLSCQGSTFQKALLISPHRFGEARGNSAPLIIREPFIACGPKECKHFALTHYA AQPGGYYNGTREDRNKLRHLISVKLGKIPTVENSIFHMAAWSGSACHDGREWTYIGVDGP DSNALIKIKYGEAYTDTYHSYANNILRTQESACNCIGGDCYLMITDGSASGISKCRFLKI REGRIIKEIFPTGRVEHTEECTCGFASNKTIECACRDNSYTAKRPFVKLNVETDTAEIRL MCTETYLDTPRPDDGSITGPCESNGDKGRGGIKGGFVHQRMASKIGRWYSRTMSKTERMG MELYVRYDGDPWTDSDALAHSGVMVSMKEPGWYSFGFEIKDKKCDVPCIGIEMVHDGGKK TWHSAATAIYCLMGSGQLLWDTVTGVDMAL
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZMR | Zanamivir | C12 H20 N4 O7 | 2 |
| CA | Calcium ion | Ca | 3 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Dihydropyrancarboxamides related to zanamivir: a new series of inhibitors of influenza virus sialidases. 2. Crystallographic and molecular modeling study of complexes of 4-amino-4H-pyran-6-carboxamides and sialidase from influenza virus types A and B. Taylor, N.R., Cleasby, A., Singh, O. et al. J Med Chem (1998) 41:798-807. DOI 10.1021/jm9703754 · PubMed
Other PDB entries of the same protein (UniProt P27907), best resolution first:
1A4G is part of these collections:
MolViewer shows 1A4G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.