1ABO: Abl tyrosine kinase

Crystal structure of the complex of the abl tyrosine kinase SH3 domain with 3BP-1 synthetic peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Oct 1995.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Mus musculus
Chains: 4
Atoms: 1,181
Mol. weight: 15.99 kDa
Released: 15 Oct 1995

Explore 1ABO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ABO contains 4 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	65-68	4	1
β-strand	72	1	2
β-strand	79	1	1
β-strand	82	1	2
β-strand	87-93	7	1
β-strand	99-104	6	1
β-strand	107-112	6	1
α-helix	113-115	3
β-strand	116-118	3	1

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Abl tyrosine kinase	A, B	protein	62	Mus musculus	P00520 (AlphaFold model)
3BP-1 synthetic peptide, 10 residues	C, D	protein	10		P55194 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1ABO_1 ABL TYROSINE KINASE (chains A, B)
MNDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPV
NS

Sequence of entity 2 (C, D), FASTA

>1ABO_2 3BP-1 SYNTHETIC PEPTIDE, 10 RESIDUES (chains C, D)
APTMPPPLPP

Primary citation

High-resolution crystal structures of tyrosine kinase SH3 domains complexed with proline-rich peptides. Musacchio, A., Saraste, M., Wilmanns, M. Nat Struct Biol (1994) 1:546-551. DOI 10.1038/nsb0894-546 · PubMed

Other PDB entries of the same protein (UniProt P00520 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KFA 1.22 Å, Structural analysis of DFG-in and DFG-out dual Src-Abl inhibitors sharing a common vinyl…
3K5V 1.74 Å, Structure of Abl kinase in complex with imatinib and GNF-2
1OPJ 1.75 Å, Structural basis for the auto-inhibition of c-Abl tyrosine kinase
1OPK 1.8 Å, Structural basis for the auto-inhibition of c-Abl tyrosine kinase
3MS9 1.8 Å, ABL kinase in complex with imatinib and a fragment (FRAG1) in the myristate pocket
5IH2 1.8 Å, Structure, thermodynamics, and the role of conformational dynamics in the interactions…
3IK3 1.9 Å, AP24534, a Pan-BCR-ABL Inhibitor for Chronic Myeloid Leukemia, Potently Inhibits the…
3KF4 1.9 Å, Structural analysis of DFG-in and DFG-out dual Src-Abl inhibitors sharing a common vinyl…
2QOH 1.95 Å, Crystal Structure of Abl kinase bound with PPY-A
2Z60 1.95 Å, Crystal Structure of the T315I Mutant of Abl kinase bound with PPY-A
3MSS 1.95 Å, Abl kinase in complex with imatinib and fragment (FRAG2) in the myristate site
3OY3 1.95 Å, Crystal structure of ABL T315I mutant kinase domain bound with a DFG-out inhibitor AP24589

Browse structure collections

About this viewer

MolViewer shows 1ABO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.