1AIJ: Photosynthetic reaction center
Photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state. Determined by X-ray diffraction at 2.2 Å resolution. Released 22 Oct 1997.
- Method
- X-ray diffraction
- Resolution
- 2.2 Å
- Organism
- Rhodobacter sphaeroides
- Chains
- 6
- Atoms
- 14,393
- Mol. weight
- 203.1 kDa
- Ligands
- BCL, BPH, U10, FE2
- Released
- 22 Oct 1997
Explore 1AIJ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1AIJ contains 104 α-helices and 65 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain H: 11 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-34 | 23 | |
| β-strand | 43 | 1 | 1 |
| β-strand | 49 | 1 | 1 |
| α-helix | 50 | 1 | |
| α-helix | 57-61 | 5 | |
| β-strand | 62-65 | 4 | 11 |
| β-strand | 72-75 | 4 | 11 |
| β-strand | 87-89 | 3 | 12 |
| β-strand | 98-100 | 3 | 12 |
| α-helix | 104-107 | 4 | |
| α-helix | 110-112 | 3 | |
| α-helix | 121-122 | 2 | |
| β-strand | 123 | 1 | 13 |
| β-strand | 129 | 1 | 13 |
| β-strand | 131-133 | 3 | 14 |
| β-strand | 141-144 | 4 | 6 |
| β-strand | 152-154 | 3 | 14 |
| β-strand | 160-170 | 11 | 14 |
| β-strand | 175-182 | 8 | 14 |
| β-strand | 188-192 | 5 | 14 |
| α-helix | 193-195 | 3 | |
| β-strand | 197-198 | 2 | 14 |
| β-strand | 203-204 | 2 | 14 |
| α-helix | 210-215 | 6 | |
| α-helix | 227-243 | 17 | |
| α-helix | 245-247 | 3 | |
| α-helix | 251-254 | 4 | |
Chain L: 18 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2 | 1 | 1 |
| α-helix | 7-9 | 3 | |
| β-strand | 25-26 | 2 | 2 |
| β-strand | 29-30 | 2 | 2 |
| α-helix | 33-56 | 24 | |
| β-strand | 66 | 1 | 3 |
| α-helix | 67-70 | 4 | |
| α-helix | 71-73 | 3 | |
| α-helix | 80-82 | 3 | |
| α-helix | 84-111 | 28 | |
| α-helix | 116-129 | 14 | |
| α-helix | 130-134 | 5 | |
| α-helix | 135-139 | 5 | |
| α-helix | 142-144 | 3 | |
| β-strand | 148 | 1 | 3 |
| α-helix | 150-163 | 14 | |
| α-helix | 167-169 | 3 | |
| α-helix | 171-198 | 28 | |
| α-helix | 205-207 | 3 | |
| α-helix | 209-220 | 12 | |
| β-strand | 222 | 1 | 4 |
| α-helix | 225-250 | 26 | |
| β-strand | 251 | 1 | 5 |
| β-strand | 255 | 1 | 5 |
| α-helix | 259-261 | 3 | |
| α-helix | 264-267 | 4 | |
Chain M: 22 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 11-13 | 3 | 6 |
| α-helix | 16-17 | 2 | |
| α-helix | 26-28 | 3 | |
| β-strand | 29 | 1 | 7 |
| β-strand | 35 | 1 | 8 |
| α-helix | 37-40 | 4 | |
| β-strand | 46 | 1 | 8 |
| β-strand | 47 | 1 | 4 |
| β-strand | 51 | 1 | 7 |
| α-helix | 54-77 | 24 | |
| α-helix | 82-87 | 6 | |
| α-helix | 89-91 | 3 | |
| β-strand | 94 | 1 | 9 |
| α-helix | 95-98 | 4 | |
| α-helix | 99-101 | 3 | |
| α-helix | 109-111 | 3 | |
| α-helix | 113-139 | 27 | |
| α-helix | 145-158 | 14 | |
| α-helix | 159-163 | 5 | |
| α-helix | 164-167 | 4 | |
| α-helix | 171-173 | 3 | |
| β-strand | 177 | 1 | 9 |
| α-helix | 179-192 | 14 | |
| α-helix | 196-198 | 3 | |
| α-helix | 200-225 | 26 | |
| α-helix | 227-229 | 3 | |
| α-helix | 234-239 | 6 | |
| α-helix | 243-256 | 14 | |
| α-helix | 265-286 | 22 | |
| β-strand | 287 | 1 | 10 |
| β-strand | 291 | 1 | 10 |
| α-helix | 294-299 | 6 | |
Chain R: 20 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-9 | 3 | |
| β-strand | 25-26 | 2 | 15 |
| β-strand | 29-30 | 2 | 15 |
| α-helix | 32-56 | 25 | |
| β-strand | 66 | 1 | 16 |
| α-helix | 67-70 | 4 | |
| α-helix | 71-73 | 3 | |
| α-helix | 80-82 | 3 | |
| α-helix | 84-111 | 28 | |
| α-helix | 116-129 | 14 | |
| α-helix | 130-134 | 5 | |
| α-helix | 135-139 | 5 | |
| α-helix | 142-144 | 3 | |
| α-helix | 146-147 | 2 | |
| β-strand | 148 | 1 | 16 |
| α-helix | 150-163 | 14 | |
| α-helix | 167-169 | 3 | |
| α-helix | 171-198 | 28 | |
| α-helix | 204-208 | 5 | |
| α-helix | 209-220 | 12 | |
| α-helix | 225-250 | 26 | |
| β-strand | 251 | 1 | 17 |
| β-strand | 255 | 1 | 17 |
| α-helix | 259-263 | 5 | |
| α-helix | 264-267 | 4 | |
| α-helix | 270-273 | 4 | |
Chain S: 20 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-13 | 4 | 18 |
| α-helix | 26-28 | 3 | |
| β-strand | 29 | 1 | 19 |
| β-strand | 35 | 1 | 20 |
| α-helix | 37-40 | 4 | |
| β-strand | 46 | 1 | 20 |
| β-strand | 51 | 1 | 19 |
| α-helix | 54-77 | 24 | |
| α-helix | 82-87 | 6 | |
| β-strand | 94 | 1 | 21 |
| α-helix | 95-98 | 4 | |
| α-helix | 99-101 | 3 | |
| α-helix | 109-111 | 3 | |
| α-helix | 113-139 | 27 | |
| α-helix | 145-158 | 14 | |
| α-helix | 159-163 | 5 | |
| α-helix | 164-167 | 4 | |
| α-helix | 171-173 | 3 | |
| β-strand | 177 | 1 | 21 |
| α-helix | 179-192 | 14 | |
| α-helix | 196-198 | 3 | |
| α-helix | 200-225 | 26 | |
| α-helix | 227-229 | 3 | |
| α-helix | 234-239 | 6 | |
| α-helix | 243-256 | 14 | |
| α-helix | 264-286 | 23 | |
| β-strand | 287 | 1 | 22 |
| β-strand | 291 | 1 | 22 |
| α-helix | 294-299 | 6 | |
Chain T: 13 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-34 | 23 | |
| β-strand | 43 | 1 | 23 |
| β-strand | 49 | 1 | 23 |
| α-helix | 50 | 1 | |
| α-helix | 57-61 | 5 | |
| β-strand | 62-65 | 4 | 24 |
| α-helix | 66 | 1 | |
| β-strand | 72-75 | 4 | 24 |
| β-strand | 87-89 | 3 | 25 |
| β-strand | 98-100 | 3 | 25 |
| α-helix | 104-107 | 4 | |
| α-helix | 110-112 | 3 | |
| β-strand | 123 | 1 | 26 |
| β-strand | 129 | 1 | 26 |
| β-strand | 131-133 | 3 | 18 |
| α-helix | 134-136 | 3 | |
| β-strand | 141-145 | 5 | 18 |
| β-strand | 152-155 | 4 | 18 |
| β-strand | 160-170 | 11 | 18 |
| β-strand | 175-183 | 9 | 18 |
| β-strand | 188-192 | 5 | 18 |
| α-helix | 193-195 | 3 | |
| β-strand | 197-198 | 2 | 18 |
| β-strand | 203-205 | 3 | 18 |
| α-helix | 210-215 | 6 | |
| α-helix | 217-219 | 3 | |
| α-helix | 227-243 | 17 | |
| α-helix | 245-247 | 3 | |
| α-helix | 251-254 | 4 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Photosynthetic reaction center (L subunit) | L, R | protein | 281 | Rhodobacter sphaeroides | P0C0Y8 (AlphaFold model) |
| Photosynthetic reaction center (M subunit) | M, S | protein | 307 | Rhodobacter sphaeroides | P0C0Y9 (AlphaFold model) |
| Photosynthetic reaction center (H subunit) | H, T | protein | 260 | Rhodobacter sphaeroides | P0C0Y7 (AlphaFold model) |
Sequence of entity 1 (L, R), FASTA
>1AIJ_1 PHOTOSYNTHETIC REACTION CENTER (L SUBUNIT) (chains L, R)
ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIAWSAVLQGTWN
PQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSWALREVEICRKLGIGYHIPFA
FAFAILAYLTLVLFRPVMMGAWGYAFPYGIWTHLDWVSNTGYTYGNFHYNPAHMIAISFF
FTNALALALHGALVLSAANPEKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSA
VFFSALCMIITGTIWFDQWVDWWQWWVKLPWWANIPGGING
Sequence of entity 2 (M, S), FASTA
>1AIJ_2 PHOTOSYNTHETIC REACTION CENTER (M SUBUNIT) (chains M, S)
AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVLSL
FSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEYGLSFAAPLKEGGLWLIASF
FMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIF
SHLDWTNNFSLVHGNLFYNPFHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIAD
RGTAAERAALFWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HGMAPLN
Sequence of entity 3 (H, T), FASTA
>1AIJ_3 PHOTOSYNTHETIC REACTION CENTER (H SUBUNIT) (chains H, T)
MVGVTAFQNFDLASLAIYSFWIFLAGLIYYLQTENMREGYPLENEDGTPAANQGPFPLPK
PKTFILPHGRGTLTVPGPESEDRPIALARTAVSEGFPHAPTGDPMKDGVGPASWVARRDL
PELDGHGHNKIKPMKAAAGFHVSAGKNPIGLPVRGCDLEIAGKVVDIWVDIPEQMARFLE
VELKDGSTRLLPMQMVKVQSNRVHVNALSSDLFAGIPTIKSPTEVTLLEEDKICGYVAGG
LMYAAPKRKSVVAAMLAEYA
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| BCL | Bacteriochlorophyll a | C55 H74 Mg N4 O6 | 8 |
| BPH | Bacteriopheophytin a | C55 H76 N4 O6 | 4 |
| U10 | Ubiquinone-10 | C59 H90 O4 | 4 |
| FE2 | FE (II) ion | Fe | 2 |
| LDA | Lauryl dimethylamine-N-oxide | C14 H31 N O | 4 |
Primary citation
Light-induced structural changes in photosynthetic reaction center: implications for mechanism of electron-proton transfer. Stowell, M.H., McPhillips, T.M., Rees, D.C. et al. Science (1997) 276:812-816. DOI 10.1126/science.276.5313.812 · PubMed
Other PDB entries of the same protein (UniProt P0C0Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7P0Q 1.73 Å, F(M197)H mutant structure of Photosynthetic Reaction Center From Rhodobacter Sphaeroides…
- 1RZH 1.8 Å, Photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp L213…
- 2J8C 1.87 Å, X-ray high resolution structure of the photosynthetic reaction center from Rb.…
- 3I4D 2.01 Å, Photosynthetic reaction center from rhodobacter sphaeroides 2.4.1
- 2UWU 2.04 Å, X-ray high resolution structure of the photosynthetic reaction center from Rb.…
- 2UWW 2.05 Å, X-ray high resolution structure of the photosynthetic reaction center from Rb.…
- 2J8D 2.07 Å, X-ray high resolution structure of the photosynthetic reaction center from Rb.…
- 1QOV 2.1 Å, Photosynthetic reaction center mutant with ala M260 replaced with trp (chain M, A260W)
- 1RY5 2.1 Å, Photosynthetic reaction center mutant from rhodobacter sphaeroides with asp L213…
- 6Z02 2.1 Å, Photosynthetic Reaction Center From Rhodobacter Sphaeroides strain RV in surfo…
- 6Z1J 2.1 Å, Photosynthetic Reaction Center From Rhodobacter Sphaeroides strain RV LSP…
- 6Z27 2.1 Å, Photosynthetic Reaction Center From Rhodobacter Sphaeroides strain RV LCP crystallization
Browse more
1AIJ is part of these collections:
About this viewer
MolViewer shows 1AIJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.