1AN8: Streptococcal superantigen spe-C

Crystal structure of the streptococcal superantigen spe-C. Determined by X-ray diffraction at 2.4 Å resolution. Released 29 Apr 1998.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Streptococcus pyogenes
Chains: 1
Atoms: 1,842
Mol. weight: 24.38 kDa
Released: 29 Apr 1998

Explore 1AN8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AN8 contains 10 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	6-17	12
α-helix	20-21	2
β-strand	22-28	7	1
β-strand	29-32	4	2
β-strand	36-40	5	2
α-helix	42-45	4
β-strand	50-54	5	2
α-helix	57-60	4
β-strand	68-73	6	1
β-strand	83-87	5	2
β-strand	90-92	3	1
α-helix	93-94	2
β-strand	100-101	2	3
α-helix	102-103	2
β-strand	104-108	5	4
β-strand	114-115	2	4
β-strand	121-122	2	3
β-strand	126-128	3	5
α-helix	129-144	16
β-strand	155-162	8	4
β-strand	167-171	5	4
α-helix	181-185	5
α-helix	186-190	5
β-strand	193-195	3	5
α-helix	196-198	3
β-strand	199-207	9	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Streptococcal pyrogenic exotoxin C	A	protein	208	Streptococcus pyogenes	Q8NKX2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AN8_1 STREPTOCOCCAL PYROGENIC EXOTOXIN C (chains A)
DSKKDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEAS
QKFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKI
ILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGT
RSDIFAKYKDNRIINMKNFSHFDIYLEK

Primary citation

Crystal structure of the streptococcal superantigen SPE-C: dimerization and zinc binding suggest a novel mode of interaction with MHC class II molecules. Roussel, A., Anderson, B.F., Baker, H.M. et al. Nat Struct Biol (1997) 4:635-643. DOI 10.1038/nsb0897-635 · PubMed

Other PDB entries of the same protein (UniProt Q8NKX2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KTK 3.0 Å, Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor…
1HQR 3.2 Å, Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on…

Browse structure collections

About this viewer

MolViewer shows 1AN8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.