1AOA: T-fimbrin

N-terminal actin-crosslinking domain from human fimbrin. Determined by X-ray diffraction at 2.4 Å resolution. Released 31 Dec 1997.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,928
Mol. weight: 30.53 kDa
Released: 31 Dec 1997

Explore 1AOA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AOA contains 19 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	123-136	14
α-helix	147	1
α-helix	149-150	2
α-helix	155-159	5
α-helix	160-162	3
α-helix	164-173	10
α-helix	180-182	3
α-helix	190-206	17
α-helix	216-220	5
α-helix	224-244	21
α-helix	261-265	5
α-helix	269-283	15
α-helix	286-288	3
α-helix	300-309	10
α-helix	318-320	3
α-helix	322-324	3
α-helix	333-344	12
α-helix	355-359	5
α-helix	363-374	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-fimbrin	A	protein	275	Homo sapiens	P13797 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AOA_1 T-FIMBRIN (chains A)
EGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAV
GDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLR
AGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFH
LENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESM
LQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFN

Primary citation

The structure of an actin-crosslinking domain from human fimbrin. Goldsmith, S.C., Pokala, N., Shen, W. et al. Nat Struct Biol (1997) 4:708-712. DOI 10.1038/nsb0997-708 · PubMed

Other PDB entries of the same protein (UniProt P13797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7R94 2.6 Å, T-Plastin-F-actin complex
7SXA 6.87 Å, T-Plastin-F-actin complex, pre-bundling intermediate state
7SX8 9.0 Å, T-Plastin-F-actin complex, parallel bundled state
7SX9 10.0 Å, T-Plastin-F-actin complex, anti-parallel bundled state
1WJO Solution structure of the forth CH domain from human plastin 3 T-isoform

Browse structure collections

About this viewer

MolViewer shows 1AOA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.