1APQ: Egf-like module of human C1R, NMR, 19 structures

Name: PDB 1APQ: Structure of the egf-like module of human C1R, NMR, 19 structures
Published: 1997-09-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: complement

Structure of the egf-like module of human C1R, NMR, 19 structures. Determined by solution NMR. Released 17 Sept 1997.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 415
Mol. weight: 5.98 kDa
Released: 17 Sept 1997

Explore 1APQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1APQ contains 0 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	47-51	5	1
β-strand	54-58	5	1
β-strand	64-65	2	2
β-strand	72-73	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement protease C1R	A	protein	53	Homo sapiens	P00736 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1APQ_1 COMPLEMENT PROTEASE C1R (chains A)
AVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQAE

Primary citation

Solution structure of the epidermal growth factor (EGF)-like module of human complement protease C1r, an atypical member of the EGF family. Bersch, B., Hernandez, J.F., Marion, D. et al. Biochemistry (1998) 37:1204-1214. DOI 10.1021/bi971851v · PubMed

Other PDB entries of the same protein (UniProt P00736 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6F1D 1.95 Å, CUB2 domain of C1r
2QY0 2.6 Å, Active dimeric structure of the catalytic domain of C1r reveals enzyme-product like…
1MD8 2.8 Å, Monomeric structure of the active catalytic domain of complement protease C1r
1GPZ 2.9 Å, The crystal structure of the zymogen catalytic domain of complement protease C1R
9EKE 3.1 Å, Structure of a C1r Zymogen Fragment Bound to SALO, Y51F Mutant
1MD7 3.2 Å, Monomeric structure of the zymogen of complement protease C1r
9EKD 3.28 Å, Structure of a C1r Zymogen Fragment Bound to SALO
7MZT 4.07 Å, Borrelia burgdorferi BBK32-C in complex with an autolytic fragment of human C1r at 4.1A
6F1C 4.2 Å, C1rC1s complex
6F1H 4.5 Å, C1rC1s complex
6F39 5.8 Å, C1r homodimer CUB1-EGF-CUB2

Browse structure collections

About this viewer

MolViewer shows 1APQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.