Crystal structure of recombinant ascorbate peroxidase. Determined by X-ray diffraction at 2.2 Å resolution. Released 8 Mar 1996.
Explore 1APX in 3D Show helices and sheets RCSB PDB PDBe
1APX contains 75 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| α-helix | 10-30 | 21 | |
| α-helix | 33-44 | 12 | |
| β-strand | 48 | 1 | 1 |
| β-strand | 53 | 1 | 1 |
| α-helix | 59-61 | 3 | |
| α-helix | 63-66 | 4 | |
| α-helix | 69-71 | 3 | |
| α-helix | 74-86 | 13 | |
| α-helix | 93-107 | 15 | |
| α-helix | 125-127 | 3 | |
| α-helix | 132-133 | 2 | |
| α-helix | 138-141 | 4 | |
| α-helix | 142-148 | 7 | |
| α-helix | 153-160 | 8 | |
| α-helix | 161-164 | 4 | |
| β-strand | 167-168 | 2 | 2 |
| β-strand | 177-178 | 2 | 2 |
| α-helix | 189-195 | 7 | |
| α-helix | 206-209 | 4 | |
| α-helix | 217-226 | 10 | |
| α-helix | 228-243 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| α-helix | 10-30 | 21 | |
| α-helix | 33-44 | 12 | |
| β-strand | 48 | 1 | 3 |
| β-strand | 53 | 1 | 3 |
| α-helix | 59-61 | 3 | |
| α-helix | 63-66 | 4 | |
| α-helix | 69-71 | 3 | |
| α-helix | 74-85 | 12 | |
| α-helix | 93-107 | 15 | |
| α-helix | 119-121 | 3 | |
| α-helix | 125-127 | 3 | |
| α-helix | 138-142 | 5 | |
| α-helix | 143-149 | 7 | |
| α-helix | 153-160 | 8 | |
| α-helix | 161-164 | 4 | |
| β-strand | 167-168 | 2 | 4 |
| α-helix | 170-173 | 4 | |
| β-strand | 177-178 | 2 | 4 |
| α-helix | 189-195 | 7 | |
| α-helix | 206-209 | 4 | |
| α-helix | 210-213 | 4 | |
| α-helix | 217-226 | 10 | |
| α-helix | 228-243 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-30 | 21 | |
| α-helix | 33-44 | 12 | |
| β-strand | 48 | 1 | 5 |
| β-strand | 53 | 1 | 5 |
| α-helix | 59-61 | 3 | |
| α-helix | 63-66 | 4 | |
| α-helix | 69-71 | 3 | |
| α-helix | 74-85 | 12 | |
| α-helix | 93-107 | 15 | |
| α-helix | 125-127 | 3 | |
| α-helix | 132-133 | 2 | |
| α-helix | 138-141 | 4 | |
| α-helix | 142-148 | 7 | |
| α-helix | 153-160 | 8 | |
| α-helix | 161-164 | 4 | |
| β-strand | 167-168 | 2 | 6 |
| α-helix | 170-173 | 4 | |
| β-strand | 177-178 | 2 | 6 |
| α-helix | 189-195 | 7 | |
| α-helix | 206-209 | 4 | |
| α-helix | 217-226 | 10 | |
| α-helix | 228-243 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-30 | 21 | |
| α-helix | 33-44 | 12 | |
| β-strand | 48 | 1 | 7 |
| β-strand | 53 | 1 | 7 |
| α-helix | 59-61 | 3 | |
| α-helix | 63-66 | 4 | |
| α-helix | 69-71 | 3 | |
| α-helix | 74-85 | 12 | |
| α-helix | 93-107 | 15 | |
| α-helix | 125-127 | 3 | |
| α-helix | 132-133 | 2 | |
| α-helix | 138-141 | 4 | |
| α-helix | 142-149 | 8 | |
| α-helix | 153-160 | 8 | |
| α-helix | 161-164 | 4 | |
| β-strand | 167-168 | 2 | 8 |
| α-helix | 170-173 | 4 | |
| β-strand | 177-178 | 2 | 8 |
| α-helix | 189-195 | 7 | |
| α-helix | 206-209 | 4 | |
| α-helix | 210-213 | 4 | |
| α-helix | 217-226 | 10 | |
| α-helix | 228-243 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytosolic ascorbate peroxidase | A, B, C, D | protein | 249 | Pisum sativum | P48534 (AlphaFold model) |
>1APX_1 CYTOSOLIC ASCORBATE PEROXIDASE (chains A, B, C, D) GKSYPTVSPDYQKAIEKAKRKLRGFIAEKKCAPLILRLAWHSAGTFDSKTKTGGPFGTIK HQAELAHGANNGLDIAVRLLEPIKEQFPIVSYADFYQLAGVVAVEITGGPEVPFHPGRED KPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWTS NPLIFDNSYFTELLTGEKDGLLQLPSDKALLTDSVFRPLVEKYAADEDVFFADYAEAHLK LSELGFAEA
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 4 |
Water and common crystallization additives (K) are not listed.
Crystal structure of recombinant pea cytosolic ascorbate peroxidase. Patterson, W.R., Poulos, T.L. Biochemistry (1995) 34:4331-4341. DOI 10.1021/bi00013a023 · PubMed
Other PDB entries of the same protein (UniProt P48534 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1APX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.