1AQK: Human FAB with high affinity for tetanus toxoid

Three-dimensional structure of a human FAB with high affinity for tetanus toxoid. Determined by X-ray diffraction at 1.84 Å resolution. Released 4 Feb 1998.

Method: X-ray diffraction
Resolution: 1.84 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,597
Mol. weight: 46.99 kDa
Released: 4 Feb 1998

Explore 1AQK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AQK contains 15 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	9
β-strand	45-51	7	9
β-strand	58-60	3	9
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-99	8	9
β-strand	110-113	4	9
β-strand	117-119	3	9
β-strand	120-121	2	8
β-strand	127	1	10
α-helix	128-129	2
β-strand	130-134	5	11
α-helix	138-140	3
β-strand	145-155	11	11
β-strand	156	1	10
β-strand	161-164	4	12
α-helix	165-167	3
β-strand	174-175	2	11
α-helix	176-178	3
β-strand	179-180	2	11
β-strand	186-195	10	11
β-strand	204-210	7	12
α-helix	211-213	3
β-strand	215-221	7	12

Chain L: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	9-12	4	2
β-strand	18-23	6	1
α-helix	29-31	3
β-strand	36-40	5	2
β-strand	47-50	4	2
β-strand	51	1	3
β-strand	55	1	3
β-strand	64-69	6	1
β-strand	72-77	6	1
α-helix	82-84	3
β-strand	86-93	8	2
β-strand	99-101	3	2
β-strand	105-109	5	2
β-strand	115	1	4
α-helix	116-117	2
β-strand	118-122	5	5
α-helix	123-125	3
α-helix	126-130	5
β-strand	134-143	10	5
β-strand	144	1	4
β-strand	149-154	6	6
β-strand	157-158	2	6
α-helix	159	1
β-strand	163-165	3	5
α-helix	166-168	3
β-strand	169-170	2	5
β-strand	176-184	9	5
α-helix	186-191	6
β-strand	195-201	7	6
β-strand	204-210	7	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FAB B7-15A2	L	protein	216	Homo sapiens	P0DOY2 (AlphaFold model)
FAB B7-15A2	H	protein	226	Homo sapiens	P01857 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1AQK_1 FAB B7-15A2 (chains L)
QNVLTQPPSVSGAPGQRVTISCTGSNSNIGAGFTVHWYQHLPGTAPKLLIFANTNRPSGV
PDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSARFGGGTRLTVLGQPKAAPSVT
LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVNAGVETTKPSKQSNNKYAASS
YLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPAECS

Sequence of entity 2 (H), FASTA

>1AQK_2 FAB B7-15A2 (chains H)
QVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYY
ADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

Primary citation

Three-dimensional structure of a human Fab with high affinity for tetanus toxoid. Faber, C., Shan, L., Fan, Z. et al. Immunotechnology (1998) 3:253-270. DOI 10.1016/S1380-2933(97)10003-3 · PubMed

Other PDB entries of the same protein (UniProt P0DOY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
4LLY 1.6 Å, Crystal structure of Pertuzumab Clambda Fab with variable and constant domain redesigns…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
4LLM 1.75 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
8ECV 1.81 Å, Bovine Fab 2F12
1JVK 1.94 Å, Three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal…
4LLW 1.95 Å, Crystal structure of Pertuzumab Clambda Fab with variable domain redesign (VRD2) at 1.95A
4EOW 1.97 Å, Crystal structure of a disease-associated anti-human GM-CSF autoantibody MB007
7FAB 2.0 Å, Crystal structure of human immunoglobulin fragment FAB new refined at 2.0 Å resolution
8ECQ 2.0 Å, Bovine Fab 2G3

Browse structure collections

About this viewer

MolViewer shows 1AQK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.