1AVQ: Lambda exonuclease

Toroidal structure of lambda exonuclease determined at 2.4 Å. Determined by X-ray diffraction at 2.4 Å resolution. Released 18 Mar 1998.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Enterobacteria phage lambda
Chains: 3
Atoms: 5,933
Mol. weight: 79.02 kDa
Ligands: PO4
Released: 18 Mar 1998

Explore 1AVQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AVQ contains 37 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
α-helix	14-16	3
α-helix	22-26	5
β-strand	32-33	2	1
α-helix	37-39	3
α-helix	49-51	3
α-helix	52-67	16
α-helix	75-96	22
β-strand	100-101	2	2
β-strand	106-107	2	1
β-strand	114-116	3	1
β-strand	120-122	3	2
β-strand	127-131	5	2
α-helix	136-145	10
α-helix	147-149	3
α-helix	152-165	14
β-strand	169-175	7	2
β-strand	184-190	7	2
α-helix	193-216	24
α-helix	223-225	3

Chain B: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
α-helix	14-16	3
α-helix	22-26	5
β-strand	32-33	2	3
α-helix	37-41	5
α-helix	49-51	3
α-helix	52-67	16
α-helix	75-96	22
β-strand	100-101	2	4
β-strand	106-107	2	3
β-strand	114-116	3	3
β-strand	120-122	3	4
β-strand	126-131	6	4
α-helix	136-145	10
α-helix	146-149	4
α-helix	152-165	14
β-strand	169-175	7	4
β-strand	184-190	7	4
α-helix	193-216	24
α-helix	223-225	3

Chain C: 13 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
α-helix	14-16	3
α-helix	22-26	5
β-strand	32-33	2	5
α-helix	34-36	3
α-helix	38-41	4
α-helix	49-51	3
α-helix	52-67	16
α-helix	75-96	22
β-strand	100-101	2	6
β-strand	106-107	2	5
β-strand	114-116	3	5
β-strand	120-122	3	6
β-strand	127-131	5	6
α-helix	136-145	10
α-helix	146-148	3
α-helix	152-165	14
β-strand	169-175	7	6
β-strand	184-190	7	6
α-helix	193-217	25
α-helix	223-225	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lambda exonuclease	A, B, C	protein	228	Enterobacteria phage lambda	P03697

Sequence of entity 1 (A, B, C), FASTA

>1AVQ_1 LAMBDA EXONUCLEASE (chains A, B, C)
SHMTPDIILQRTGIDVRAVEQGDDAWHKLRLGVITASEVHNVIAKPRSGKKWPDMKMSYF
HTLLAEVCTGVAPEVNAKALAWGKQYENDARTLFEFTSGVNVTESPIIYRDESMRTACSP
DGLCSDGNGLELKCPFTSRDFMKFRLGGFEAIKSAYMAQVQYSMWVTRKNAWYFANYDPR
MKREGLHYVVIERDEKYMASFDEIVPEFIEKMDEALAEIGFVFGEQWR

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	3

Water and common crystallization additives (ACT) are not listed.

Primary citation

Toroidal structure of lambda-exonuclease. Kovall, R., Matthews, B.W. Science (1997) 277:1824-1827. DOI 10.1126/science.277.5333.1824 · PubMed

Other PDB entries of the same protein (UniProt P03697), best resolution first:

3SM4 1.88 Å, Crystal Structure of the K131A Mutant of Lambda Exonuclease in Complex with a…
3SLP 2.3 Å, Crystal Structure of Lambda Exonuclease in Complex with a 12 BP Symmetric DNA Duplex
6M9K 2.3 Å, Crystal structure of lambda exonuclease in complex with the Red beta C-terminal domain
4WUZ 2.38 Å, Crystal structure of lambda exonuclease in complex with DNA and Ca2+

Browse structure collections

About this viewer

MolViewer shows 1AVQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.