1AVT: Subtilisin carlsberg, type VIII

Subtilisin carlsberg D-para-chlorophenyl-1-acetamido boronic acid inhibitor complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 25 Mar 1998.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Bacillus licheniformis
Chains: 1
Atoms: 2,090
Mol. weight: 27.59 kDa
Released: 25 Mar 1998

Explore 1AVT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AVT contains 13 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-18	6
β-strand	27-32	6	1
β-strand	44-49	6	1
α-helix	64-73	10
β-strand	89-94	6	1
α-helix	104-116	13
β-strand	121-124	4	1
β-strand	128	1	2
α-helix	133-144	12
β-strand	148-152	5	1
β-strand	159	1	3
β-strand	162	1	3
β-strand	167	1	2
β-strand	175-180	6	1
α-helix	185	1
β-strand	186	1	1
α-helix	187	1
β-strand	198-201	4	1
β-strand	205-209	5	4
β-strand	213-217	5	4
α-helix	220-237	18
α-helix	243-252	10
α-helix	254	1
β-strand	255	1	1
α-helix	256	1
α-helix	260-263	4
β-strand	267	1	1
α-helix	270-273	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Subtilisin carlsberg, type VIII	A	protein	274	Bacillus licheniformis	P00780 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AVT_1 SUBTILISIN CARLSBERG, TYPE VIII (chains A)
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDG
NGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDV
INMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNSGSTNTIGYPAKYDSVIAVGAVD
SNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTXMASPHVAGAAALILSKHPNL
SASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ

Primary citation

Differences in binding modes of enantiomers of 1-acetamido boronic acid based protease inhibitors: crystal structures of gamma-chymotrypsin and subtilisin Carlsberg complexes. Stoll, V.S., Eger, B.T., Hynes, R.C. et al. Biochemistry (1998) 37:451-462. DOI 10.1021/bi971166o · PubMed

Other PDB entries of the same protein (UniProt P00780 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1R0R 1.1 Å, 1.1 Angstrom Resolution Structure of the Complex Between the Protein Inhibitor, OMTKY3,…
1CSE 1.2 Å, The high-resolution X-ray crystal structure of the complex formed between subtilisin…
3UNX 1.26 Å, Bond length analysis of asp, glu and his residues in subtilisin Carlsberg at 1.26A…
6DWQ 1.27 Å, Subtilisin serine protease modified with the protease inhibitor…
1YU6 1.55 Å, Crystal Structure of the Subtilisin Carlsberg:OMTKY3 Complex
2SEC 1.8 Å, Structural comparison of two serine proteinase-protein inhibitor complexes.…
1SCN 1.9 Å, Inactivation of subtilisin carlsberg by N-(tert-butoxycarbonyl-alanyl-prolyl-phenylalanyl…
1SCA 2.0 Å, Enzyme crystal structure in a neat organic solvent
1SEL 2.0 Å, Crystal structure of selenosubtilisin at 2.0-Å resolution
1VSB 2.1 Å, Subtilisin carlsberg L-para-chlorophenyl-1-acetamido boronic acid inhibitor complex
1BE6 2.15 Å, Trans-cinnamoyl-subtilisin in anhydrous acetonitrile
1C3L 2.16 Å, Subtilisin-carlsberg complexed with xenon (8 bar)

Browse structure collections

About this viewer

MolViewer shows 1AVT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.