1B1Z: Streptococcal pyrogenic exotoxin A1

Name: PDB 1B1Z: Streptococcal pyrogenic exotoxin A1
Published: 1999-11-24
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Streptococcal pyrogenic exotoxin A1. Determined by X-ray diffraction at 2.57 Å resolution. Released 24 Nov 1999.

Method: X-ray diffraction
Resolution: 2.57 Å
Organism: Streptococcus pyogenes
Chains: 4
Atoms: 7,114
Mol. weight: 102.25 kDa
Released: 24 Nov 1999

Explore 1B1Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B1Z contains 34 α-helices and 74 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	10-11	2
α-helix	12-14	3
α-helix	19-26	8
α-helix	28-29	2
β-strand	30-36	7	1
β-strand	39	1	2
β-strand	45-48	4	2
β-strand	52	1	3
β-strand	55	1	3
β-strand	57-61	5	2
α-helix	65-71	7
β-strand	75-80	6	1
β-strand	83	1	2
β-strand	96-100	5	2
β-strand	103-105	3	1
β-strand	110-123	14	4
β-strand	126-137	12	4
β-strand	139-141	3	5
α-helix	142-157	16
β-strand	169-175	7	4
β-strand	182-185	4	4
α-helix	194-197	4
α-helix	198-201	4
β-strand	206-208	3	5
β-strand	213-219	7	4

Chain B: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	10-11	2
α-helix	12-14	3
α-helix	19-26	8
α-helix	28-29	2
β-strand	30-35	6	6
β-strand	39	1	7
β-strand	45-48	4	7
β-strand	52	1	8
β-strand	55	1	8
β-strand	57-61	5	7
α-helix	65-71	7
β-strand	76-80	5	6
β-strand	83	1	7
β-strand	96-100	5	7
β-strand	103-105	3	6
β-strand	110-123	14	9
β-strand	126-137	12	9
β-strand	139-141	3	10
α-helix	142-157	16
β-strand	169-175	7	9
β-strand	182-185	4	9
α-helix	194-197	4
α-helix	198-201	4
β-strand	206-208	3	10
β-strand	213-219	7	9

Chain C: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	10-11	2
α-helix	12-14	3
α-helix	19-26	8
α-helix	28-29	2
β-strand	30-36	7	11
β-strand	39	1	12
β-strand	45-48	4	12
β-strand	52	1	13
β-strand	55	1	13
β-strand	57-61	5	12
α-helix	65-71	7
β-strand	75-80	6	11
β-strand	83	1	12
β-strand	96-100	5	12
β-strand	103-105	3	11
β-strand	110-123	14	14
β-strand	126-137	12	14
β-strand	139-141	3	15
α-helix	142-157	16
β-strand	161	1	16
β-strand	163	1	16
β-strand	169-175	7	14
α-helix	180-181	2
β-strand	182-185	4	14
α-helix	194-197	4
α-helix	198-201	4
β-strand	206-208	3	15
β-strand	213-219	7	14

Chain D: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
α-helix	19-26	8
β-strand	30-36	7	17
β-strand	39	1	18
β-strand	45-48	4	18
β-strand	52	1	19
β-strand	55	1	19
β-strand	57-61	5	18
α-helix	65-71	7
β-strand	75-80	6	17
β-strand	83	1	18
β-strand	96-100	5	18
β-strand	103-105	3	17
β-strand	110	1	20
β-strand	117-120	4	21
β-strand	123	1	21
β-strand	126	1	21
β-strand	130-133	4	21
β-strand	137	1	20
β-strand	139-141	3	22
α-helix	142-157	16
β-strand	170-176	7	21
β-strand	182-185	4	21
α-helix	194-197	4
α-helix	198-201	4
β-strand	206-208	3	22
β-strand	212-218	7	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (TOXIN)	A, B, C, D	protein	219	Streptococcus pyogenes	P0DJY7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1B1Z_1 PROTEIN (TOXIN) (chains A, B, C, D)
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTEL
KNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVS
IDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESF
WFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTTK

Primary citation

Structural basis for the recognition of superantigen streptococcal pyrogenic exotoxin A (SpeA1) by MHC class II molecules and T-cell receptors. Papageorgiou, A.C., Collins, C.M., Gutman, D.M. et al. EMBO J (1999) 18:9-21. DOI 10.1093/emboj/18.1.9 · PubMed

Other PDB entries of the same protein (UniProt P0DJY7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1L0Y 2.5 Å, T cell receptor beta chain complexed with superantigen SpeA soaked with zinc
1UUP 2.6 Å, Crystal Structure of A Dimeric Form of Streptococcal Pyrogenic Exotoxin A (SpeA1).
1L0X 2.8 Å, TCR beta chain complexed with streptococcal superantigen SpeA
1HA5 2.82 Å, Structural features of a zinc-binding site in the superantigen streptococcal pyrogenic…
1FNV 3.6 Å, Structure of streptococcal pyrogenic exotoxin a
1FNW 3.9 Å, Crystal structure of streptococcal pyrogenic exotoxin a

Browse structure collections

About this viewer

MolViewer shows 1B1Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.