1B2T: CX3C chemokine domain of fractalkine

Name: PDB 1B2T: Solution structure of the CX3C chemokine domain of fractalkine
Published: 1999-04-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chemokine

Solution structure of the CX3C chemokine domain of fractalkine. Determined by solution NMR. Released 8 Apr 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 611
Mol. weight: 8.79 kDa
Released: 8 Apr 1999

Explore 1B2T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B2T contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	21-23	3
β-strand	24-29	6	1
β-strand	39-43	5	1
β-strand	47-51	5	1
α-helix	56-65	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (fractalkine)	A	protein	77	Homo sapiens	P78423 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1B2T_1 PROTEIN (FRACTALKINE) (chains A)
MQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVK
DAMQHLDRQAAALTRNG

Primary citation

Solution structure and dynamics of the CX3C chemokine domain of fractalkine and its interaction with an N-terminal fragment of CX3CR1. Mizoue, L.S., Bazan, J.F., Johnson, E.C. et al. Biochemistry (1999) 38:1402-1414. DOI 10.1021/bi9820614 · PubMed

Other PDB entries of the same protein (UniProt P78423 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F2L 2.0 Å, Crystal structure of chemokine domain of fractalkine
9XIX 2.58 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the C-state
3ONA 2.6 Å, The SECRET domain in complex with CX3CL1
9XJP 2.74 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the E-state, chemokine domain fully…
9XJ5 2.81 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the C-state, full chemokine domain…
9XIY 2.86 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the T2C-state
4XT1 2.89 Å, Structure of a nanobody-bound viral GPCR bound to human chemokine CX3CL1
9XJ7 2.89 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the C'-state with AHD visible
7XBX 3.4 Å, Cryo-EM structure of the human chemokine receptor CX3CR1 in complex with CX3CL1 and Gi1
5WB2 3.5 Å, US28 bound to engineered chemokine CX3CL1.35 and nanobodies
7RKM 3.5 Å, Structure of CX3CL1-US28-Gi-scFv16 in C-state
7RKN 3.6 Å, Structure of CX3CL1-US28-Gi-scFv16 in OC-state

Browse structure collections

About this viewer

MolViewer shows 1B2T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.