1B3T: Ebna-1 nuclear protein/dna complex

Name: PDB 1B3T: Ebna-1 nuclear protein/dna complex
Published: 1998-12-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: protein/dna

Ebna-1 nuclear protein/dna complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Dec 1998.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Human herpesvirus 4
Chains: 4
Atoms: 3,164
Mol. weight: 43.05 kDa
Released: 15 Dec 1998

Explore 1B3T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B3T contains 14 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	476-489	14
β-strand	503-511	9	1
α-helix	514-527	14
β-strand	532-533	2	1
α-helix	534-536	3
β-strand	537-540	4	1
α-helix	543-544	2
α-helix	549-552	4
β-strand	556-566	11	1
α-helix	569-584	16
α-helix	587	1
α-helix	590-592	3
β-strand	593-604	12	1

Chain B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	476-491	16
β-strand	503-511	9	1
α-helix	514-527	14
β-strand	532-533	2	1
β-strand	537-540	4	1
α-helix	543-544	2
β-strand	556-566	11	1
α-helix	569-583	15
α-helix	587	1
α-helix	590-592	3
β-strand	593-604	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(gpgpgpapapgpcpaptpaptpgpcptptpcpcpc)-3')	C, D	DNA	18
Protein (nuclear protein EBNA1)	A, B	protein	147	Human herpesvirus 4	P03211 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>1B3T_1 DNA (5'-D(*GP*GP*GP*AP*AP*GP*CP*AP*TP*AP*TP*GP*CP*TP*TP*CP*CP*C)-3') (chains C, D)
GGGAAGCATATGCTTCCC

Sequence of entity 2 (A, B), FASTA

>1B3T_2 PROTEIN (NUCLEAR PROTEIN EBNA1) (chains A, B)
KGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNL
RRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIK
DLVMTKPAPTCNIRVTVCSFDDGVDLP

Primary citation

The 2.2 A structure of a permanganate-sensitive DNA site bound by the Epstein-Barr virus origin binding protein, EBNA1. Bochkarev, A., Bochkareva, E., Frappier, L. et al. J Mol Biol (1998) 284:1273-1278. DOI 10.1006/jmbi.1998.2247 · PubMed

Other PDB entries of the same protein (UniProt P03211 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VH6 1.3 Å, Crystal structure of Epstein-Barr Virus Nuclear Antigen-1, EBNA1, bound to fragment
6NPP 1.35 Å, Crystal structure of Epstein-Barr Virus Nuclear Antigen-1, EBNA1, bound to fragments
2FYY 1.5 Å, The role of T cell receptor alpha genes in directing human MHC restriction
6NPI 1.5 Å, Crystal structure of Epstein-Barr Virus Nuclear Antigen-1, EBNA1, bound to fragments
6NPM 1.6 Å, Crystal structure of Epstein-Barr Virus Nuclear Antigen-1, EBNA1, bound to fragments
4PRE 1.65 Å, Crystal structure of a HLA-B*35:08-HPVG-Q5
1YY6 1.7 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with an EBNA1…
4PRA 1.85 Å, Crystal structure of a HLA-B*35:01-HPVG-Q5
2FZ3 1.9 Å, The role of T cell receptor alpha genes in directing human MHC restriction
5WMF 1.9 Å, Crystal structure of the Hexameric Ring of Epstein-Barr Virus Nuclear Antigen-1, EBNA1
3MV7 2.0 Å, Crystal Structure of the TK3 TCR in complex with HLA-B*3501/HPVG
5WUM 2.0 Å, Crystal structure of mouse importin-alpha1 bound to S385-phosphorylated NLS of EBNA1

Browse structure collections

About this viewer

MolViewer shows 1B3T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.