Crystal structure of the human killer cell inhibitory receptor (KIR2DL3) specific for HLA-CW3 related alleles. Determined by X-ray diffraction at 3.0 Å resolution. Released 27 Jan 1999.
Explore 1B6U in 3D Show helices and sheets RCSB PDB PDBe
1B6U contains 2 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-10 | 2 | 1 |
| β-strand | 13 | 1 | 1 |
| β-strand | 17-19 | 3 | 2 |
| β-strand | 24-30 | 7 | 1 |
| β-strand | 36-42 | 7 | 3 |
| β-strand | 47-52 | 6 | 3 |
| β-strand | 54 | 1 | 1 |
| β-strand | 60-66 | 7 | 1 |
| β-strand | 75-82 | 8 | 3 |
| α-helix | 92-96 | 5 | |
| β-strand | 97-99 | 3 | 3 |
| β-strand | 100-102 | 3 | 2 |
| β-strand | 109-111 | 3 | 4 |
| β-strand | 119 | 1 | 5 |
| β-strand | 123-129 | 7 | 4 |
| β-strand | 136-141 | 6 | 6 |
| β-strand | 147-148 | 2 | 6 |
| β-strand | 151 | 1 | 6 |
| β-strand | 153 | 1 | 7 |
| β-strand | 161 | 1 | 7 |
| β-strand | 162-168 | 7 | 4 |
| β-strand | 173-180 | 8 | 6 |
| β-strand | 187 | 1 | 2 |
| β-strand | 188 | 1 | 6 |
| α-helix | 190-194 | 5 | |
| β-strand | 195-197 | 3 | 6 |
| β-strand | 200 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| P58 killer cell inhibitory receptor | A | protein | 257 | Homo sapiens | P43628 (AlphaFold model) |
>1B6U_1 P58 KILLER CELL INHIBITORY RECEPTOR (chains A) HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVS KANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLA GESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGS FRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLHAAAEQKLISEEDLNLD LVPRGSSSHHHHHHSSG
Crystal structure of the human p58 killer cell inhibitory receptor (KIR2DL3) specific for HLA-Cw3-related MHC class I. Maenaka, K., Juji, T., Stuart, D.I. et al. Structure (1999) 7:391-398. DOI 10.1016/S0969-2126(99)80052-5 · PubMed
Other PDB entries of the same protein (UniProt P43628 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1B6U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.