1B88: V-alpha 2.6 mouse T cell receptor (TCR) domain

V-alpha 2.6 mouse T cell receptor (TCR) domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 Feb 1999.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,818
Mol. weight: 25.4 kDa
Released: 16 Feb 1999

Explore 1B88 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B88 contains 4 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-12	3	2
β-strand	13-14	2	3
β-strand	17-25	9	1
β-strand	32-38	7	2
β-strand	45-51	7	2
β-strand	58	1	1
β-strand	63-67	5	1
β-strand	72-80	9	1
α-helix	82-84	3
β-strand	87-93	7	2
α-helix	100-101	2
β-strand	102-104	3	2
β-strand	108-109	2	2
β-strand	112-113	2	3

Chain B: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	204-207	4	4
β-strand	210-214	5	2
α-helix	217-218	2
β-strand	219-225	7	4
β-strand	232	1	5
β-strand	235-238	4	6
β-strand	245-248	4	6
β-strand	251	1	5
β-strand	256-258	3	4
β-strand	262-267	6	4
β-strand	272-277	6	4
α-helix	282-284	3
β-strand	287-290	4	6
β-strand	291-292	2	7
β-strand	293	1	5
β-strand	303-304	2	7
β-strand	308-309	2	6
β-strand	311-313	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T cell receptor V-alpha domain	A, B	protein	114	Mus musculus	Q5R1B3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1B88_1 T CELL RECEPTOR V-ALPHA DOMAIN (chains A, B)
MQQVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVSNKKEDG
RFTIFFNKREKKLSLHIADSQPGDSATYFCAASASFGDNSKLIWGLGTSLVVNP

Primary citation

The X-ray crystal structure of a Valpha2.6Jalpha38 mouse T cell receptor domain at 2.5 A resolution: alternate modes of dimerization and crystal packing. Plaksin, D., Chacko, S., Navaza, J. et al. J Mol Biol (1999) 289:1153-1161. DOI 10.1006/jmbi.1999.2855 · PubMed

Other PDB entries of the same protein (UniProt Q5R1B3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1U3H 2.42 Å, Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A
2P1Y 2.42 Å, 1.B2.D9, a bispecific alpha/beta TCR

Browse structure collections

About this viewer

MolViewer shows 1B88 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.