Crystal structure of a chimeric FAB' fragment of an antibody binding tumour cells. Determined by X-ray diffraction at 3.1 Å resolution. Released 31 Jan 1994.
Explore 1BBJ in 3D Show helices and sheets RCSB PDB PDBe
1BBJ contains 36 α-helices and 94 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 13 |
| β-strand | 10-14 | 5 | 14 |
| β-strand | 19-25 | 7 | 13 |
| β-strand | 33-38 | 6 | 14 |
| β-strand | 45-49 | 5 | 14 |
| β-strand | 53-54 | 2 | 14 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 13 |
| β-strand | 70-75 | 6 | 13 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 14 |
| β-strand | 98 | 1 | 14 |
| β-strand | 102-107 | 6 | 14 |
| β-strand | 111 | 1 | 15 |
| β-strand | 114-118 | 5 | 16 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-125 | 4 | |
| β-strand | 129-139 | 11 | 16 |
| β-strand | 140 | 1 | 15 |
| β-strand | 145-149 | 5 | 17 |
| β-strand | 154-155 | 2 | 17 |
| β-strand | 159-163 | 5 | 16 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 16 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-197 | 7 | 17 |
| β-strand | 199 | 1 | 18 |
| β-strand | 201 | 1 | 18 |
| β-strand | 205-210 | 6 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 19 |
| α-helix | 7-9 | 3 | |
| β-strand | 10-12 | 3 | 20 |
| β-strand | 18-25 | 8 | 19 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 20 |
| β-strand | 45-51 | 7 | 20 |
| β-strand | 58-60 | 3 | 20 |
| α-helix | 62-64 | 3 | |
| β-strand | 65 | 1 | 19 |
| β-strand | 68-73 | 6 | 19 |
| β-strand | 78-83 | 6 | 19 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-96 | 5 | 20 |
| β-strand | 97 | 1 | 21 |
| α-helix | 103 | 1 | |
| β-strand | 104 | 1 | 21 |
| α-helix | 105 | 1 | |
| β-strand | 108-112 | 5 | 20 |
| α-helix | 116-117 | 2 | |
| β-strand | 118 | 1 | 22 |
| α-helix | 119-120 | 2 | |
| β-strand | 121-125 | 5 | 23 |
| β-strand | 137-146 | 10 | 23 |
| β-strand | 147 | 1 | 22 |
| β-strand | 152-155 | 4 | 24 |
| α-helix | 156-158 | 3 | |
| β-strand | 160 | 1 | 24 |
| β-strand | 164-166 | 3 | 23 |
| α-helix | 167-169 | 3 | |
| β-strand | 170-171 | 2 | 23 |
| β-strand | 177-185 | 9 | 23 |
| α-helix | 187-189 | 3 | |
| β-strand | 196-201 | 6 | 24 |
| α-helix | 202-204 | 3 | |
| β-strand | 206-211 | 6 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| IGG4-kappa B72.3 FAB (light chain) | A, L | protein | 211 | Mus musculus, Homo sapiens | |
| IGG4-kappa B72.3 FAB (heavy chain) | B, H | protein | 212 | Mus musculus, Homo sapiens | P01861 (AlphaFold model) |
>1BBJ_1 IGG4-KAPPA B72.3 FAB (LIGHT CHAIN) (chains A, L) DIQMTQSPASLSVSVGETVTITCRASENIYSNLAWYQQKQGKSPQLLVYAATNLADGVPS RFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGTPYTFGGGTRLEIKRADAAPTVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
>1BBJ_2 IGG4-KAPPA B72.3 FAB (HEAVY CHAIN) (chains B, H) QVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWAKQKPEQGLEWIGYISPGNDDIKY NEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCKRSYYGHWGQGTTLTVSSASTKGP SVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRV
Crystal structure of a chimeric Fab' fragment of an antibody binding tumour cells. Brady, R.L., Edwards, D.J., Hubbard, R.E. et al. J Mol Biol (1992) 227:253-264. DOI 10.1016/0022-2836(92)90695-G · PubMed
Other PDB entries of the same protein (UniProt P01861 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BBJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.