1BJ4: Recombinant serine hydroxymethyltransferase

Name: PDB 1BJ4: Recombinant serine hydroxymethyltransferase (HUMAN)
Published: 1999-08-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Recombinant serine hydroxymethyltransferase (HUMAN). Determined by X-ray diffraction at 2.65 Å resolution. Released 16 Aug 1999.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,728
Mol. weight: 51.97 kDa
Ligands: PLP
Released: 16 Aug 1999

Explore 1BJ4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BJ4 contains 30 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	13-21	9
α-helix	26-29	4
α-helix	31-46	16
β-strand	48-49	2	1
α-helix	59-65	7
α-helix	68-70	3
β-strand	76-77	2	2
β-strand	80-81	2	2
α-helix	87-103	17
β-strand	111-114	4	3
α-helix	120-127	8
α-helix	128-132	5
β-strand	137-141	5	3
α-helix	143-145	3
α-helix	149-151	3
β-strand	154	1	4
β-strand	159	1	4
α-helix	162-166	5
β-strand	168-172	5	3
β-strand	174	1	5
β-strand	181	1	5
α-helix	183-193	11
β-strand	197-200	4	3
α-helix	211-220	10
β-strand	224-228	5	3
α-helix	230-232	3
α-helix	233-237	5
α-helix	244-246	3
β-strand	250-254	5	3
α-helix	257-259	3
β-strand	265-270	6	3
β-strand	273-276	4	6
α-helix	282	1
β-strand	283-285	3	6
α-helix	286	1
α-helix	288-294	7
α-helix	295-300	6
α-helix	306-318	13
α-helix	322-344	23
α-helix	347	1
β-strand	348-349	2	7
β-strand	358-362	5	7
α-helix	363-366	4
α-helix	370-379	10
β-strand	382-383	2	1
β-strand	385-387	3	7
β-strand	400-404	5	7
α-helix	406-410	5
α-helix	415-438	24
α-helix	445-452	8
α-helix	458-472	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine hydroxymethyltransferase, cytosolic	A	protein	470	Homo sapiens	P34896 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BJ4_1 Serine hydroxymethyltransferase, cytosolic (chains A)
DADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLN
NKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTA
LVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENA
RLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHV
VTTTTHKTLRGCRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPGLQGGPHNHAIA
GVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDG
GRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIE
LTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGL

Ligands and cofactors

ID	Name	Formula	Copies
PLP	Pyridoxal-5'-phosphate	C8 H10 N O6 P	1

Primary citation

The crystal structure of human cytosolic serine hydroxymethyltransferase: a target for cancer chemotherapy. Renwick, S.B., Snell, K., Baumann, U. Structure (1998) 6:1105-1116. DOI 10.1016/S0969-2126(98)00112-9 · PubMed

Other PDB entries of the same protein (UniProt P34896 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RJP 1.25 Å, Crystal structure of human Bromodomain containing protein 4 (BRD4) in complex with SHMT
7RJL 1.5 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with SHMT
6M5W 3.1 Å, Co-crystal structure of human serine hydroxymethyltransferase 1 in complex with…
8R7H 3.29 Å, Cryo-EM structure of Human SHMT1
8XND 3.45 Å, Crystal structure of serine hydroxymethyltransferase 1
8A11 3.52 Å, Cryo-EM structure of the Human SHMT1-RNA complex
6FL5 3.6 Å, Structure of human SHMT1-H135N-R137A-E168N mutant at 3.6 Ang. resolution

Browse structure collections

About this viewer

MolViewer shows 1BJ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.