1BMR: Lqh III alpha-like toxin

Name: PDB 1BMR: Alpha-like toxin lqh III from scorpion leiurus quinquestriatus hebraeus, NMR, 25 structures
Published: 1999-02-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Alpha-like toxin lqh III from scorpion leiurus quinquestriatus hebraeus, NMR, 25 structures. Determined by solution NMR. Released 16 Feb 1999.

Method: Solution NMR
Organism: Leiurus quinquestriatus hebraeus
Chains: 1
Atoms: 490
Mol. weight: 7.06 kDa
Released: 16 Feb 1999

Explore 1BMR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BMR contains 1 α-helix and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	21-30	10
β-strand	34-40	7	1
β-strand	44-52	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lqh III alpha-like toxin	A	protein	68	Leiurus quinquestriatus hebraeus	P56678 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BMR_1 LQH III ALPHA-LIKE TOXIN (chains A)
VRDGYIAQPENCVYHCFPGSSGCDTLCKEKGGTSGHCGFKVGHGLACWCNALPDNVGIIV
EGEKCHSX

Primary citation

NMR structures and activity of a novel alpha-like toxin from the scorpion Leiurus quinquestriatus hebraeus. Krimm, I., Gilles, N., Sautiere, P. et al. J Mol Biol (1999) 285:1749-1763. DOI 10.1006/jmbi.1998.2418 · PubMed

Other PDB entries of the same protein (UniProt P56678 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7K18 3.3 Å, Cardiac Sodium channel with toxin bound
7XSU 3.4 Å, Cardiac sodium channel in complex with LqhIII
1FH3 NMR structures of lqh III alpha-like scorpion toxin from leiurus quinquestriatus…

Browse structure collections

About this viewer

MolViewer shows 1BMR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.