1BOT: Protein

Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. Determined by X-ray diffraction at 3.05 Å resolution. Released 19 Jan 1999.

Method: X-ray diffraction
Resolution: 3.05 Å
Organism: Escherichia coli
Chains: 2
Atoms: 7,864
Mol. weight: 112.75 kDa
Released: 19 Jan 1999

Explore 1BOT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BOT contains 39 α-helices and 58 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain O: 19 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	1
β-strand	15-22	8	1
β-strand	27-34	8	1
β-strand	38	1	2
β-strand	46-47	2	2
α-helix	49-66	18
α-helix	71-73	3
β-strand	74-81	8	1
β-strand	86-90	5	2
β-strand	96-101	6	2
α-helix	110-118	9
α-helix	121-128	8
α-helix	137-147	11
α-helix	151-156	6
β-strand	160-163	4	2
α-helix	165-174	10
β-strand	180-182	3	3
α-helix	183-186	4
β-strand	192	1	4
β-strand	199	1	4
α-helix	201-203	3
α-helix	204-208	5
α-helix	211-213	3
β-strand	216-218	3	3
β-strand	221-227	7	1
β-strand	237-244	8	1
α-helix	245-252	8
β-strand	261-265	5	5
β-strand	269-274	6	5
β-strand	287-292	6	5
β-strand	298-306	9	5
α-helix	310-318	9
α-helix	329-333	5
β-strand	343-345	3	6
β-strand	348	1	7
β-strand	350	1	7
β-strand	352	1	5
β-strand	363-365	3	6
α-helix	373-399	27
β-strand	405-407	3	8
β-strand	408-409	2	5
α-helix	411-414	4
α-helix	416-426	11
β-strand	429-433	5	8
α-helix	438-449	12
β-strand	466-470	5	8
α-helix	476-493	18

Chain Z: 20 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	9
β-strand	15-22	8	9
β-strand	27-34	8	9
β-strand	38	1	10
β-strand	42	1	11
β-strand	44	1	11
β-strand	46-47	2	10
α-helix	49-66	18
α-helix	71-73	3
β-strand	74-81	8	9
β-strand	86-90	5	10
β-strand	96-101	6	10
α-helix	102	1
α-helix	109-117	9
α-helix	121-127	7
α-helix	137-147	11
α-helix	152-157	6
β-strand	160-164	5	10
α-helix	165-173	9
β-strand	180-182	3	12
α-helix	183-186	4
β-strand	192-193	2	13
β-strand	198-199	2	13
α-helix	201-207	7
β-strand	216-218	3	12
β-strand	225-228	4	9
β-strand	236-244	9	9
α-helix	245-252	8
β-strand	261-265	5	14
β-strand	269-276	8	14
β-strand	287-293	7	14
β-strand	297-306	10	14
α-helix	310-314	5
α-helix	315-319	5
α-helix	329-334	6
β-strand	343-345	3	15
β-strand	348	1	16
β-strand	350	1	16
β-strand	352	1	14
β-strand	363-365	3	15
α-helix	373-399	27
β-strand	405-407	3	17
β-strand	408-409	2	14
α-helix	411-414	4
α-helix	416-426	11
β-strand	429-433	5	17
α-helix	438-450	13
α-helix	457-460	4
β-strand	466-470	5	17
α-helix	476-493	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (glycerol kinase)	O, Z	protein	501	Escherichia coli	P0A6F3 (AlphaFold model)

Sequence of entity 1 (O, Z), FASTA

>1BOT_1 PROTEIN (GLYCEROL KINASE) (chains O, Z)
TEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTL
VEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGL
EDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVHV
TDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPIS
GIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVNY
ALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPYA
RGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLMQ
FQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTERN
YRYAGWKKAVKRAMAWEEHDE

Primary citation

Crystal structure of a complex of Escherichia coli glycerol kinase and an allosteric effector fructose 1,6-bisphosphate. Ormo, M., Bystrom, C.E., Remington, S.J. Biochemistry (1998) 37:16565-16572. DOI 10.1021/bi981616s · PubMed

Other PDB entries of the same protein (UniProt P0A6F3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EZW 2.0 Å, Crystal Structure of a Hyperactive Escherichia coli Glycerol Kinase Mutant Gly230 -->…
1BU6 2.37 Å, Crystal structures of escherichia coli glycerol kinase and the mutant A65T in an…
1GLA 2.6 Å, Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase
1GLB 2.6 Å, Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase
1GLF 2.62 Å, Crystal structures of escherichia coli glycerol kinase and the mutant A65T in an…
1GLC 2.65 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
1GLD 2.93 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
1GLE 2.94 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
1BWF 3.0 Å, Escherichia coli glycerol kinase mutant with bound ATP analog showing substantial domain…
1GLJ 3.0 Å, Escherichia coli glycerol kinase mutant with bound ATP analog showing substantial domain…
1GLL 3.0 Å, Escherichia coli glycerol kinase mutant with bound ATP analog showing substantial domain…
1BO5 3.2 Å, Crystal structure of the complex between escherichia coli glycerol kinase and the…

Browse structure collections

About this viewer

MolViewer shows 1BOT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.