Smooth muscle myosin motor domain complexed with MGADP.ALF4. Determined by X-ray diffraction at 2.9 Å resolution. Released 9 Sept 1998.
Explore 1BR2 in 3D Show helices and sheets RCSB PDB PDBe
1BR2 contains 210 α-helices and 150 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 35-38 | 4 | 1 |
| β-strand | 44-48 | 5 | 1 |
| β-strand | 57-61 | 5 | 1 |
| β-strand | 67-70 | 4 | 1 |
| β-strand | 76-77 | 2 | 1 |
| α-helix | 81-83 | 3 | |
| β-strand | 88 | 1 | 2 |
| α-helix | 97-109 | 13 | |
| β-strand | 114-116 | 3 | 2 |
| β-strand | 121-124 | 4 | 2 |
| α-helix | 135-140 | 6 | |
| α-helix | 146-148 | 3 | |
| α-helix | 153-167 | 15 | |
| β-strand | 171-176 | 6 | 2 |
| α-helix | 183-198 | 16 | |
| α-helix | 219-224 | 6 | |
| α-helix | 227-235 | 9 | |
| β-strand | 236-237 | 2 | 3 |
| β-strand | 245-246 | 2 | 3 |
| β-strand | 249-256 | 8 | 2 |
| β-strand | 262-270 | 9 | 2 |
| α-helix | 274-277 | 4 | |
| β-strand | 287 | 1 | 3 |
| α-helix | 288-296 | 9 | |
| α-helix | 299-302 | 4 | |
| α-helix | 328-342 | 15 | |
| α-helix | 346-364 | 19 | |
| β-strand | 368 | 1 | 4 |
| β-strand | 377 | 1 | 4 |
| α-helix | 382-391 | 10 | |
| α-helix | 395-403 | 9 | |
| α-helix | 420-450 | 31 | |
| β-strand | 459-465 | 7 | 2 |
| α-helix | 466-469 | 4 | |
| β-strand | 475 | 1 | 5 |
| α-helix | 477-494 | 18 | |
| α-helix | 495-500 | 6 | |
| α-helix | 501-507 | 7 | |
| α-helix | 522-529 | 8 | |
| α-helix | 537-544 | 8 | |
| α-helix | 552-562 | 11 | |
| β-strand | 569-571 | 3 | 5 |
| β-strand | 580-585 | 6 | 5 |
| β-strand | 588-593 | 6 | 5 |
| α-helix | 597-602 | 6 | |
| α-helix | 607-614 | 8 | |
| α-helix | 619-624 | 6 | |
| α-helix | 659-675 | 17 | |
| β-strand | 678-685 | 8 | 2 |
| α-helix | 686 | 1 | |
| α-helix | 698-707 | 10 | |
| α-helix | 710-719 | 10 | |
| β-strand | 723-726 | 4 | 6 |
| α-helix | 727-734 | 8 | |
| α-helix | 735-738 | 4 | |
| α-helix | 749-760 | 12 | |
| α-helix | 764-766 | 3 | |
| β-strand | 767-769 | 3 | 6 |
| β-strand | 773-776 | 4 | 6 |
| α-helix | 780-788 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin | A, B, C, D, E, F | protein | 791 | Gallus gallus | P10587 (AlphaFold model) |
>1BR2_1 MYOSIN (chains A, B, C, D, E, F) AQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVEL QENGKKVTLSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFC VVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGA GKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVK NDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQM RNDLLLEGFNNYTFLSNGHVPIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVLQ LGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKE QADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQLC INYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLALL DEECWFPKATDTSFVEKLIQEQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKN MDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQ LYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGF PNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVL AHLEEERDLKI
| ID | Name | Formula | Copies |
|---|---|---|---|
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 6 |
| ALF | Tetrafluoroaluminate ion | Al F4 | 6 |
| MG | Magnesium ion | Mg | 6 |
Crystal structure of a vertebrate smooth muscle myosin motor domain and its complex with the essential light chain: visualization of the pre-power stroke state. Dominguez, R., Freyzon, Y., Trybus, K.M. et al. Cell (1998) 94:559-571. DOI 10.1016/S0092-8674(00)81598-6 · PubMed
Other PDB entries of the same protein (UniProt P10587 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BR2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.