1BR4: Myosin

Smooth muscle myosin motor domain-essential light chain complex with MGADP.BEF3 bound at the active site. Determined by X-ray diffraction at 3.62 Å resolution. Released 9 Sept 1998.

Method: X-ray diffraction
Resolution: 3.62 Å
Organism: Gallus gallus
Chains: 8
Atoms: 29,948
Mol. weight: 444.35 kDa
Ligands: BEF, ADP, MG
Released: 9 Sept 1998

Explore 1BR4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BR4 contains 197 α-helices and 124 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and E: 39 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	23-27	5
α-helix	28-31	4
β-strand	34-37	4	1
β-strand	45-52	8	1
β-strand	56-61	6	1
β-strand	70-71	2	1
β-strand	76	1	1
α-helix	77-80	4
α-helix	81-83	3
β-strand	88	1	2
α-helix	89-91	3
α-helix	99-109	11
β-strand	116	1	2
β-strand	117	1	3
β-strand	120	1	3
β-strand	121-122	2	4
α-helix	135-141	7
α-helix	153-167	15
β-strand	171-174	4	5
α-helix	183-197	15
α-helix	220-223	4
α-helix	228-231	4
α-helix	233-235	3
β-strand	236-239	4	6
β-strand	242-246	5	6
β-strand	249	1	7
β-strand	250-256	7	5
β-strand	262-267	6	5
β-strand	270	1	7
α-helix	274-276	3
α-helix	289-296	8
α-helix	299-303	5
α-helix	322-323	2
α-helix	328-342	15
α-helix	346-361	16
α-helix	382-391	10
α-helix	395-403	9
α-helix	421-449	29
β-strand	459-465	7	5
β-strand	475	1	8
α-helix	478-494	17
α-helix	495-500	6
α-helix	501-508	8
α-helix	522-526	5
α-helix	537-544	8
α-helix	552-563	12
β-strand	569-571	3	8
β-strand	581-584	4	8
β-strand	589-592	4	8
α-helix	598-601	4
α-helix	607-614	8
α-helix	619-624	6
α-helix	659-664	6
α-helix	667-674	8
β-strand	678-681	4	5
β-strand	682-683	2	4
α-helix	698-706	9
α-helix	710-719	10
β-strand	725	1	9
α-helix	727-733	7
α-helix	749-759	11
β-strand	768-769	2	9
β-strand	774-775	2	9
α-helix	782-790	9
α-helix	793-820	28

Chains B, D and F: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	25	1	10
α-helix	32-37	6
α-helix	46-50	5
α-helix	56-59	4
β-strand	65	1	10
α-helix	66-77	12
α-helix	85-93	9
β-strand	103-104	2	11
α-helix	105-111	7
α-helix	118-120	3
α-helix	121-128	8
β-strand	137-138	2	11
α-helix	140-148	9

Chains C and G: 39 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	23-27	5
α-helix	28-31	4
β-strand	34-37	4	12
β-strand	45-52	8	12
β-strand	56-61	6	12
β-strand	70-71	2	12
β-strand	76	1	12
α-helix	77-80	4
α-helix	81-83	3
β-strand	88	1	13
α-helix	89-91	3
α-helix	99-109	11
β-strand	116	1	13
β-strand	117	1	14
β-strand	120	1	14
β-strand	121-122	2	15
α-helix	135-141	7
α-helix	153-167	15
β-strand	171-174	4	16
α-helix	183-197	15
α-helix	220-223	4
α-helix	228-231	4
α-helix	233-235	3
β-strand	236-239	4	17
β-strand	242-246	5	17
β-strand	249	1	18
β-strand	250-256	7	16
β-strand	262-267	6	16
β-strand	270	1	18
α-helix	274-276	3
α-helix	289-296	8
α-helix	299-303	5
α-helix	322-323	2
α-helix	328-342	15
α-helix	346-361	16
α-helix	382-388	7
α-helix	395-403	9
α-helix	421-449	29
β-strand	459-465	7	16
β-strand	475	1	19
α-helix	478-494	17
α-helix	495-500	6
α-helix	501-508	8
α-helix	522-526	5
α-helix	537-544	8
α-helix	552-563	12
β-strand	569-571	3	19
β-strand	581-584	4	19
β-strand	589-592	4	19
α-helix	598-601	4
α-helix	607-614	8
α-helix	619-624	6
α-helix	659-664	6
α-helix	667-674	8
β-strand	678-681	4	16
β-strand	682-683	2	15
α-helix	698-706	9
α-helix	710-719	10
β-strand	725	1	20
α-helix	727-733	7
α-helix	749-759	11
β-strand	768-769	2	20
β-strand	774-775	2	20
α-helix	782-790	9
α-helix	793-820	28

Chain H: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	25	1	43
α-helix	32-37	6
α-helix	46-50	5
α-helix	56-59	4
β-strand	65	1	43
α-helix	66-77	12
α-helix	85-87	3
α-helix	88-93	6
β-strand	103-104	2	44
α-helix	105-111	7
α-helix	118-120	3
α-helix	121-128	8
β-strand	137-138	2	44
α-helix	140-148	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin	A, C, E, G	protein	820	Gallus gallus	P10587 (AlphaFold model)
Myosin	B, D, F, H	protein	150	Gallus gallus	P02607 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>1BR4_1 MYOSIN (chains A, C, E, G)
AQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVEL
QENGKKVTLSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFC
VVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGA
GKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVK
NDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQM
RNDLLLEGFNNYTFLSNGHVPIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVLQ
LGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKE
QADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQLC
INYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLALL
DEECWFPKATDTSFVEKLIQEQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKN
MDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQ
LYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGF
PNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVL
AHLEEERDLKITDVIIAFQAQCRGYLARKAFAKRQQQLGS

Sequence of entity 2 (B, D, F, H), FASTA

>1BR4_2 MYOSIN (chains B, D, F, H)
CDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMN
LKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT
EEEVEQLVAGHEDSNGCINYEELVRMVLSG

Ligands and cofactors

ID	Name	Formula	Copies
BEF	Beryllium trifluoride ion	Be F3	4
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	4
MG	Magnesium ion	Mg	4

Primary citation

Crystal structure of a vertebrate smooth muscle myosin motor domain and its complex with the essential light chain: visualization of the pre-power stroke state. Dominguez, R., Freyzon, Y., Trybus, K.M. et al. Cell (1998) 94:559-571. DOI 10.1016/S0092-8674(00)81598-6 · PubMed

Other PDB entries of the same protein (UniProt P10587 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M05 2.67 Å, Chicken smooth muscle myosin motor domain co-crystallized with the specific CK-571…
5T45 2.8 Å, Chicken smooth muscle myosin motor domain co-crystallized with the specific CK-571…
1BR2 2.9 Å, Smooth muscle myosin motor domain complexed with MGADP.ALF4
7MF3 3.4 Å, Structure of the autoinhibited state of smooth muscle myosin-2
1BR1 3.5 Å, Smooth muscle myosin motor domain-essential light chain complex with MGADP.ALF4 bound at…
6BIH 6.0 Å, The Structure of the Actin-Smooth Muscle Myosin Motor Domain Complex in the Rigor State
8SYF 19.0 Å, Homology model of Acto-HMM complex in ADP-state. Chicken smooth muscle HMM and chicken…
1I84 20.0 Å, cryo-EM structure of the heavy meromyosin subfragment of chicken gizzard smooth muscle…
3DTP 20.0 Å, Tarantula heavy meromyosin obtained by flexible docking to Tarantula muscle thick…
3J04 20.0 Å, EM structure of the heavy meromyosin subfragment of Chick smooth muscle Myosin with…

Browse structure collections

About this viewer

MolViewer shows 1BR4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.