1BR9: Human tissue inhibitor of metalloproteinase-2

Human tissue inhibitor of metalloproteinase-2. Determined by X-ray diffraction at 2.1 Å resolution. Released 4 May 1999.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,482
Mol. weight: 21.78 kDa
Released: 4 May 1999

Explore 1BR9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BR9 contains 8 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	8-14	7
β-strand	17-33	17	1
β-strand	39-54	16	1
α-helix	59-60	2
β-strand	62-65	4	1
α-helix	69-71	3
β-strand	83-92	10	1
β-strand	95-97	3	1
β-strand	104-106	3	1
α-helix	107-109	3
α-helix	112-117	6
α-helix	123-125	3
β-strand	129-132	4	2
β-strand	145-148	4	2
α-helix	150-154	5
α-helix	160-164	5
β-strand	166-169	4	3
β-strand	175-178	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metalloproteinase-2 inhibitor	A	protein	194	Homo sapiens	P16035 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BR9_1 METALLOPROTEINASE-2 INHIBITOR (chains A)
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDI
EFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNH
RYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRG
AAPPKQEFLDIEDP

Primary citation

Three-dimensional structure of human tissue inhibitor of metalloproteinases-2 at 2.1 A resolution. Tuuttila, A., Morgunova, E., Bergmann, U. et al. J Mol Biol (1998) 284:1133-1140. DOI 10.1006/jmbi.1998.2223 · PubMed

Other PDB entries of the same protein (UniProt P16035 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ILW 2.1 Å, Complex of matrix metalloproteinase-10 catalytic domain (MMP-10cd) with tissue inhibitor…
1GXD 3.1 Å, proMMP-2/TIMP-2 complex
2TMP N-terminal domain of tissue inhibitor of metalloproteinase-2 (N-timp-2), NMR, 49…

Browse structure collections

About this viewer

MolViewer shows 1BR9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.