1BRB: Rat anionic trypsin

Crystal structures of rat anionic trypsin complexed with the protein inhibitors appi and bpti. Determined by X-ray diffraction at 2.1 Å resolution. Released 31 Jul 1994.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,184
Mol. weight: 30.22 kDa
Released: 31 Jul 1994

Explore 1BRB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BRB contains 11 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-34	5	3
β-strand	40-48	9	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	64-68	4	3
β-strand	72	1	4
β-strand	81-90	10	3
β-strand	104-108	5	3
β-strand	122	1	2
α-helix	123-124	2
α-helix	128-130	3
β-strand	135-140	6	2
β-strand	154	1	4
α-helix	155	1
β-strand	156-162	7	2
α-helix	163-164	2
α-helix	165-171	7
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-201	4	2
β-strand	204-215	8	2
β-strand	226-230	5	2
α-helix	231-233	3
α-helix	235-244	10

Chain I: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-9	2
β-strand	14	1	2
β-strand	18-24	7	5
β-strand	29-35	7	5
β-strand	45	1	5
α-helix	48-54	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trypsin	E	protein	223	Rattus norvegicus	P00763 (AlphaFold model)
Pancreatic trypsin inhibitor	I	protein	58		P00974 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>1BRB_1 TRYPSIN (chains E)
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEG
NEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISG
WGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKGSCQGDSGGP
VVCNGELQGIVSWGYGCALPDNPDVYTKVCNYVDWIQDTIAAN

Sequence of entity 2 (I), FASTA

>1BRB_2 PANCREATIC TRYPSIN INHIBITOR (chains I)
RPDFAGEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTAGGA

Primary citation

Crystal structures of rat anionic trypsin complexed with the protein inhibitors APPI and BPTI. Perona, J.J., Tsu, C.A., Craik, C.S. et al. J Mol Biol (1993) 230:919-933. DOI 10.1006/jmbi.1993.1210 · PubMed

Other PDB entries of the same protein (UniProt P00763 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FP7 1.46 Å, Anionic trypsin variant S195A in complex with bovine pancreatic trypsin inhibitor (BPTI)…
3FP8 1.46 Å, Anionic trypsin variant S195A in complex with bovine pancreatic trypsin inhibitor (BPTI)…
3FP6 1.49 Å, Anionic trypsin in complex with bovine pancreatic trypsin inhibitor (BPTI) determined to…
1F7Z 1.55 Å, Rat trypsinogen K15A complexed with bovine pancreatic trypsin inhibitor
1DPO 1.59 Å, Structure of rat trypsin
1J16 1.6 Å, Benzamidine in complex with rat trypsin mutant X99/175/190RT
1F5R 1.65 Å, Rat trypsinogen mutant complexed with bovine pancreatic trypsin inhibitor
1FY8 1.7 Å, Crystal structure of the DELTAILE16VAL17 rat anionic trypsinogen-bpti complex
1YKT 1.7 Å, Trypsin/Bpti complex mutant
1YLC 1.7 Å, Trypsin/BPTI complex mutant
1YLD 1.7 Å, Trypsin/BPTI complex mutant
3TGK 1.7 Å, Trypsinogen mutant D194N and deletion of ile 16-val 17 complexed with bovine pancreatic…

Browse structure collections

About this viewer

MolViewer shows 1BRB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.