Structure of the binding site for inositol phosphates in a PH domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Mar 1996.
Explore 1BTN in 3D Show helices and sheets RCSB PDB PDBe
1BTN contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-11 | 10 | 1 |
| α-helix | 16 | 1 | |
| β-strand | 17 | 1 | 1 |
| α-helix | 18 | 1 | |
| β-strand | 24-31 | 8 | 1 |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 41-46 | 6 | |
| α-helix | 53-55 | 3 | |
| β-strand | 56-57 | 2 | 1 |
| β-strand | 62-65 | 4 | 1 |
| β-strand | 75-79 | 5 | 1 |
| β-strand | 85-89 | 5 | 1 |
| α-helix | 93-105 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-spectrin | A | protein | 106 | Mus musculus | Q62261 (AlphaFold model) |
>1BTN_1 BETA-SPECTRIN (chains A) MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKE AICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA
| ID | Name | Formula | Copies |
|---|---|---|---|
| I3P | D-myo-inositol-1,4,5-triphosphate | C6 H15 O15 P3 | 1 |
Structure of the binding site for inositol phosphates in a PH domain. Hyvonen, M., Macias, M.J., Nilges, M. et al. EMBO J (1995) 14:4676-4685. PubMed
Other PDB entries of the same protein (UniProt Q62261 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BTN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.