1BUY: Protein

Human erythropoietin, NMR minimized average structure. Determined by solution NMR. Released 10 Sept 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,297
Mol. weight: 18.46 kDa
Released: 10 Sept 1999

Explore 1BUY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BUY contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	9-26	18
β-strand	41	1	1
α-helix	48-51	4
α-helix	56-83	28
α-helix	92-111	20
α-helix	132	1
β-strand	133	1	1
α-helix	134	1
α-helix	138-148	11
α-helix	149-153	5
α-helix	154-161	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (erythropoietin)	A	protein	166	Homo sapiens	P01588 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BUY_1 PROTEIN (ERYTHROPOIETIN) (chains A)
APPRLICDSRVLERYLLEAKEAEKITTGCAEHCSLNEKITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVKSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS
PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Primary citation

NMR structure of human erythropoietin and a comparison with its receptor bound conformation. Cheetham, J.C., Smith, D.M., Aoki, K.H. et al. Nat Struct Biol (1998) 5:861-866. DOI 10.1038/2302 · PubMed

Other PDB entries of the same protein (UniProt P01588 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EER 1.9 Å, Crystal structure of human erythropoietin complexed to its receptor at 1.9 Å
1CN4 2.8 Å, Erythropoietin complexed with extracellular domains of erythropoietin receptor

Browse structure collections

About this viewer

MolViewer shows 1BUY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.