Conformational model for the consensus V3 loop of the envelope protein GP120 of HIV-1. Determined by solution NMR. Released 18 Mar 1999.
Explore 1CE4 in 3D Show helices and sheets RCSB PDB PDBe
1CE4 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| α-helix | 18-21 | 4 | |
| α-helix | 23-32 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (V3 loop of HIV-1 envelope protein) | A | protein | 35 | P20871 |
>1CE4_1 PROTEIN (V3 LOOP OF HIV-1 ENVELOPE PROTEIN) (chains A) CTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHC
The complete Consensus V3 loop peptide of the envelope protein gp120 of HIV-1 shows pronounced helical character in solution. Vranken, W.F., Budesinsky, M., Fant, F. et al. FEBS Lett (1995) 374:117-121. DOI 10.1016/0014-5793(95)01086-T · PubMed
Other PDB entries of the same protein (UniProt P20871), best resolution first:
MolViewer shows 1CE4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.