1CEE: CDC42

Solution structure of CDC42 in complex with the gtpase binding domain of wasp. Determined by solution NMR. Released 30 Jun 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,880
Mol. weight: 26.81 kDa
Ligands: GCP, MG
Released: 30 Jun 1999

Explore 1CEE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CEE contains 11 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	16-25	10
β-strand	37-46	10	1
β-strand	49-57	9	1
α-helix	69-71	3
β-strand	77-80	4	1
β-strand	82-83	2	1
α-helix	87-92	6
α-helix	93-97	5
α-helix	99-102	4
β-strand	111-115	5	1
α-helix	117-120	4
α-helix	123-130	8
α-helix	139-148	10
β-strand	153-156	4	1
α-helix	165-176	12

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	16-21	6	1
α-helix	36-42	7
α-helix	56-58	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GTP-binding rho-like protein	A	protein	179	Homo sapiens	P60953 (AlphaFold model)
Wiskott-aldrich syndrome protein wasp	B	protein	59	Homo sapiens	P42768 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CEE_1 GTP-BINDING RHO-LIKE PROTEIN (chains A)
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP

Sequence of entity 2 (B), FASTA

>1CEE_2 WISKOTT-ALDRICH SYNDROME PROTEIN WASP (chains B)
KKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSK

Ligands and cofactors

ID	Name	Formula	Copies
GCP	Phosphomethylphosphonic acid guanylate ester	C11 H18 N5 O13 P3	1
MG	Magnesium ion	Mg	1

Primary citation

Structure of Cdc42 in complex with the GTPase-binding domain of the 'Wiskott-Aldrich syndrome' protein. Abdul-Manan, N., Aghazadeh, B., Liu, G.A. et al. Nature (1999) 399:379-383. DOI 10.1038/20726 · PubMed

Other PDB entries of the same protein (UniProt P60953 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NGR 1.9 Å, Transition state complex for GTP hydrolysis by CDC42: comparisons of the high resolution…
4JS0 1.9 Å, Complex of Cdc42 with the CRIB-PR domain of IRSp53
6SUP 2.0 Å, Crystal Structure of TcdB2-TccC3-Cdc42
3VHL 2.08 Å, Crystal structure of the DHR-2 domain of DOCK8 in complex with Cdc42 (T17N mutant)
1GRN 2.1 Å, Crystal structure of the CDC42/CDC42GAP/ALF3 complex.
1NF3 2.1 Å, Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity…
2DFK 2.15 Å, Crystal structure of the CDC42-Collybistin II complex
2WM9 2.2 Å, Structure of the complex between DOCK9 and Cdc42.
2WMO 2.2 Å, Structure of the complex between DOCK9 and Cdc42.
1GZS 2.3 Å, Crystal structure of the complex between the gef domain of the salmonella typhimurium…
1KI1 2.3 Å, Guanine Nucleotide Exchange Region of Intersectin in Complex with Cdc42
3GCG 2.3 Å, crystal structure of MAP and CDC42 complex

Browse structure collections

About this viewer

MolViewer shows 1CEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.