1CF4: CDC42/ACK gtpase-binding domain complex

CDC42/ACK gtpase-binding domain complex. Determined by solution NMR. Released 18 Jun 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,813
Mol. weight: 25.83 kDa
Ligands: GNP, MG
Released: 18 Jun 1999

Explore 1CF4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CF4 contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	18-24	7
α-helix	34-36	3
β-strand	45	1	1
β-strand	51	1	1
α-helix	90-104	15
β-strand	113	1	2
α-helix	117-120	4
α-helix	123-130	8
α-helix	139-148	10
β-strand	155	1	2
α-helix	166-177	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (CDC42 homolog)	A	protein	184	Homo sapiens	P60953 (AlphaFold model)
Protein (activated P21CDC42HS kinase)	B	protein	44	Homo sapiens	Q07912 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CF4_1 PROTEIN (CDC42 HOMOLOG) (chains A)
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
LEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKK

Sequence of entity 2 (B), FASTA

>1CF4_2 PROTEIN (ACTIVATED P21CDC42HS KINASE) (chains B)
GSGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGN

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1
MG	Magnesium ion	Mg	1

Primary citation

Structure of the small G protein Cdc42 bound to the GTPase-binding domain of ACK. Mott, H.R., Owen, D., Nietlispach, D. et al. Nature (1999) 399:384-388. DOI 10.1038/20732 · PubMed

Other PDB entries of the same protein (UniProt P60953 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NGR 1.9 Å, Transition state complex for GTP hydrolysis by CDC42: comparisons of the high resolution…
4JS0 1.9 Å, Complex of Cdc42 with the CRIB-PR domain of IRSp53
6SUP 2.0 Å, Crystal Structure of TcdB2-TccC3-Cdc42
3VHL 2.08 Å, Crystal structure of the DHR-2 domain of DOCK8 in complex with Cdc42 (T17N mutant)
1GRN 2.1 Å, Crystal structure of the CDC42/CDC42GAP/ALF3 complex.
1NF3 2.1 Å, Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity…
2DFK 2.15 Å, Crystal structure of the CDC42-Collybistin II complex
2WM9 2.2 Å, Structure of the complex between DOCK9 and Cdc42.
2WMO 2.2 Å, Structure of the complex between DOCK9 and Cdc42.
1GZS 2.3 Å, Crystal structure of the complex between the gef domain of the salmonella typhimurium…
1KI1 2.3 Å, Guanine Nucleotide Exchange Region of Intersectin in Complex with Cdc42
3GCG 2.3 Å, crystal structure of MAP and CDC42 complex

Browse structure collections

About this viewer

MolViewer shows 1CF4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.