1CF7: Protein

Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-dp. Determined by X-ray diffraction at 2.6 Å resolution. Released 2 Apr 1999.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,873
Mol. weight: 28.98 kDa
Released: 2 Apr 1999

Explore 1CF7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CF7 contains 7 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	22-35	14
β-strand	40-42	3	1
α-helix	43-49	7
α-helix	56-68	13
β-strand	71-75	5	1
β-strand	78-81	4	1

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	70-85	16
β-strand	87-88	2	2
α-helix	90-102	13
α-helix	109-111	3
α-helix	113-132	20
β-strand	136	1	3
β-strand	143-144	2	2
β-strand	145	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(aptptptptpcpgpcpgpcpgpgptptptpt)-3')	C	DNA	16
DNA (5'-d(tpapapapapcpcpgpcpgpcpgpapapapa)-3')	D	DNA	16
Protein (transcription factor E2F-4)	A	protein	76	Homo sapiens	Q16254 (AlphaFold model)
Protein (transcription factor dp-2)	B	protein	95	Homo sapiens	Q14188 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1CF7_1 DNA (5'-D(*AP*TP*TP*TP*TP*CP*GP*CP*GP*CP*GP*GP*TP*TP*TP*T)-3') (chains C)
ATTTTCGCGCGGTTTT

Sequence of entity 2 (D), FASTA

>1CF7_2 DNA (5'-D(*TP*AP*AP*AP*AP*CP*CP*GP*CP*GP*CP*GP*AP*AP*AP*A)-3') (chains D)
TAAAACCGCGCGAAAA

Sequence of entity 3 (A), FASTA

>1CF7_3 PROTEIN (TRANSCRIPTION FACTOR E2F-4) (chains A)
PPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGL
IEKKSKNSIQWKGVGP

Sequence of entity 4 (B), FASTA

>1CF7_4 PROTEIN (TRANSCRIPTION FACTOR DP-2) (chains B)
RSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNI
RRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQ

Primary citation

Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP. Zheng, N., Fraenkel, E., Pabo, C.O. et al. Genes Dev (1999) 13:666-674. PubMed

Other PDB entries of the same protein (UniProt Q16254 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TUU 2.25 Å, Crystal structure of the E2F4-DP1 coiled coil and marked-box domains

Browse structure collections

About this viewer

MolViewer shows 1CF7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.