1CGS: IGG2B-kappa NC6.8 FAB

Local and transmitted conformational changes on complexation of an anti-sweetener FAB. Determined by X-ray diffraction at 2.6 Å resolution. Released 31 May 1994.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,412
Mol. weight: 47.03 kDa
Released: 31 May 1994

Explore 1CGS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CGS contains 5 α-helices and 53 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 3 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	10
β-strand	10-12	3	11
β-strand	15	1	12
β-strand	18-21	4	13
β-strand	22-25	4	10
β-strand	33-40	8	11
β-strand	44-47	4	11
α-helix	62-64	3
β-strand	65	1	13
β-strand	68-69	2	13
β-strand	72-73	2	14
β-strand	78-79	2	14
β-strand	80-83	4	13
β-strand	86	1	12
β-strand	92-99	8	11
β-strand	105-106	2	11
β-strand	110-114	5	11
β-strand	120	1	15
β-strand	123-125	3	16
β-strand	138-146	9	16
β-strand	149	1	15
β-strand	154-156	3	17
β-strand	166-167	2	16
β-strand	172	1	18
α-helix	174-176	3
β-strand	179	1	18
β-strand	180-187	8	16
α-helix	190-193	4
β-strand	197-202	6	17
β-strand	207-212	6	17

Chain L: 2 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	10-13	4	2
β-strand	20	1	3
β-strand	23-25	3	1
β-strand	39-40	2	4
β-strand	41-42	2	5
β-strand	43	1	2
β-strand	50-51	2	5
β-strand	67-71	5	3
β-strand	76-80	5	3
β-strand	90-91	2	2
β-strand	93-94	2	4
β-strand	103	1	4
β-strand	107-111	5	2
β-strand	116	1	6
β-strand	119-123	5	7
α-helix	127-131	5
β-strand	134-144	11	7
β-strand	145	1	6
β-strand	150-152	3	8
β-strand	154	1	9
β-strand	155	1	8
β-strand	160	1	9
β-strand	164-167	4	7
β-strand	178-187	10	7
α-helix	188-191	4
β-strand	196-202	7	8
β-strand	210-215	6	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IGG2B-kappa NC6.8 FAB (light chain)	L	protein	219	Mus musculus	A2P1G9 (AlphaFold model)
IGG2B-kappa NC6.8 FAB (heavy chain)	H	protein	214	Mus musculus

Sequence of entity 1 (L), FASTA

>1CGS_1 IGG2B-KAPPA NC6.8 FAB (LIGHT CHAIN) (chains L)
ELVMTQSPLSLPVSLGDQASISCRPSQSLVHSNGNTYLHWYLQKPGQSPKLLIYRVSNRF
SGVPDRFSGSGSGTAFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLELKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1CGS_2 IGG2B-KAPPA NC6.8 FAB (HEAVY CHAIN) (chains H)
RVQLLESGAELMKPGASVQISCKATGYTFSEYWIEWVKERPGHGLEWIGEILPGSGRTNY
REKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTT
PPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTM
SSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE

Primary citation

Local and transmitted conformational changes on complexation of an anti-sweetener Fab. Guddat, L.W., Shan, L., Anchin, J.M. et al. J Mol Biol (1994) 236:247-274. DOI 10.1006/jmbi.1994.1133 · PubMed

Other PDB entries of the same protein (UniProt A2P1G9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YNL 1.7 Å, Identification of Key residues of the NC6.8 Fab antibody fragment binding to synthetic…
1YNK 2.1 Å, Identification of Key residues of the NC6.8 Fab antibody fragment binding to synthetic…
2CGR 2.2 Å, Local and transmitted conformational changes on complexation of an anti-sweetener FAB
4ZXB 3.3 Å, Structure of the human insulin receptor ectodomain, IRDeltabeta construct, in complex…

Browse structure collections

About this viewer

MolViewer shows 1CGS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.