1CK4: Rat A1B1 integrin I-domain

Crystal structure of rat A1B1 integrin I-domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 3 May 2000.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 3,258
Mol. weight: 44.24 kDa
Released: 3 May 2000

Explore 1CK4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CK4 contains 28 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	148-154	7	1
α-helix	162-173	12
β-strand	184-191	8	1
β-strand	193-198	6	1
α-helix	206-214	9
α-helix	226-232	7
α-helix	233-237	5
α-helix	240-242	3
α-helix	248-249	2
β-strand	250-256	7	1
α-helix	263-265	3
α-helix	266-275	10
β-strand	278-285	8	1
α-helix	287-291	5
α-helix	297-304	8
α-helix	308	1
α-helix	311-314	4
β-strand	315-318	4	1
α-helix	322-326	5
α-helix	328-335	8

Chain B: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	147-154	8	2
α-helix	162-173	12
β-strand	178	1	3
β-strand	183	1	3
β-strand	184-191	8	2
β-strand	193-198	6	2
α-helix	206-213	8
α-helix	226-232	7
α-helix	233-237	5
α-helix	244-245	2
α-helix	248	1
β-strand	249-256	8	2
α-helix	263-265	3
α-helix	266-275	10
β-strand	279-285	7	2
α-helix	287-291	5
α-helix	297-306	10
α-helix	308	1
α-helix	311-314	4
β-strand	315-318	4	2
α-helix	321-326	6
α-helix	328-337	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-1	A, B	protein	198	Rattus norvegicus	P18614 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1CK4_1 INTEGRIN ALPHA-1 (chains A, B)
CSTQLDIVIVLDGSNSIYPWESVIAFLNDLLKRMDIGPKQTQVGIVQYGENVTHEFNLNK
YSSTEEVLVAANKIGRQGGLQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHD
NYRLKQVIQDCEDENIQRFSIAILGHYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDEL
ALVTIVKALGERIFALEA

Primary citation

Crystal structure of the alpha1beta1 integrin I-domain: insights into integrin I-domain function. Nolte, M., Pepinsky, R.B., Venyaminov, S.Y.u. et al. FEBS Lett (1999) 452:379-385. DOI 10.1016/S0014-5793(99)00666-3 · PubMed

Other PDB entries of the same protein (UniProt P18614 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2B2X 2.2 Å, VLA1 RdeltaH I-domain complexed with a quadruple mutant of the AQC2 Fab
1MHP 2.8 Å, Crystal structure of a chimeric alpha1 integrin I-domain in complex with the Fab…

Browse structure collections

About this viewer

MolViewer shows 1CK4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.