1CLZ: IgG FAB (IGG3, kappa) fragment

IgG FAB (IGG3, kappa) fragment (MBR96) complexed with lewis Y nonoate methyl ester. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 Aug 1996.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,431
Mol. weight: 48.85 kDa
Ligands: NON
Released: 1 Aug 1996

Explore 1CLZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CLZ contains 11 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 4 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-40	7	7
β-strand	44-51	8	7
β-strand	57-58	2	7
β-strand	64	1	6
β-strand	67-72	6	6
β-strand	77-82	6	6
α-helix	84-86	3
β-strand	88-96	9	7
β-strand	100-103	6	7
β-strand	108-111	4	7
β-strand	117	1	8
β-strand	120-124	5	9
β-strand	135	1	9
β-strand	137-147	11	9
β-strand	148	1	8
β-strand	153-157	4	10
β-strand	171-173	3	9
α-helix	174-176	3
β-strand	177-178	2	9
β-strand	185-194	10	9
β-strand	205-212	7	10
α-helix	213-215	3
β-strand	217-223	7	10

Chain L: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	44-49	6	2
β-strand	53-54	2	2
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-107	6	2
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	146-150	5	5
β-strand	155	1	5
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-196	6	5
α-helix	204	1
β-strand	205-210	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgG FAB (IGG3, kappa)	L	protein	219	Mus musculus
IgG FAB (IGG3, kappa)	H	protein	218	Mus musculus	P03987 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1CLZ_1 IGG FAB (IGG3, KAPPA) (chains L)
DVLMTQIPVSLPVSLGDQASISCRSSQIIVHNNGNTYLEWYLQKPGQSPQLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1CLZ_2 IGG FAB (IGG3, KAPPA) (chains H)
EVNLVESGGGLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDY
PDTVKGRFTISRDNAKNSLYLQMSRLKSEDTAMYYCARGLDDGAWFAYWGQGTLVTVSVT
TTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFY
SLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR

Ligands and cofactors

ID	Name	Formula	Copies
NON	Methyl nonanoate (ESTER)	C10 H20 O2	1

Primary citation

The x-ray structure of an anti-tumour antibody in complex with antigen. Jeffrey, P.D., Bajorath, J., Chang, C.Y. et al. Nat Struct Biol (1995) 2:466-471. DOI 10.1038/nsb0695-466 · PubMed

Other PDB entries of the same protein (UniProt P03987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VQ1 2.5 Å, anti trimeric Lewis X Fab54-5C10-A

Browse structure collections

About this viewer

MolViewer shows 1CLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.