IgG FAB (IGG3, kappa) fragment (MBR96) complexed with lewis Y nonoate methyl ester. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 Aug 1996.
Explore 1CLZ in 3D Show helices and sheets RCSB PDB PDBe
1CLZ contains 11 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 6 |
| β-strand | 10-12 | 3 | 7 |
| β-strand | 18-25 | 8 | 6 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-40 | 7 | 7 |
| β-strand | 44-51 | 8 | 7 |
| β-strand | 57-58 | 2 | 7 |
| β-strand | 64 | 1 | 6 |
| β-strand | 67-72 | 6 | 6 |
| β-strand | 77-82 | 6 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 7 |
| β-strand | 100-103 | 6 | 7 |
| β-strand | 108-111 | 4 | 7 |
| β-strand | 117 | 1 | 8 |
| β-strand | 120-124 | 5 | 9 |
| β-strand | 135 | 1 | 9 |
| β-strand | 137-147 | 11 | 9 |
| β-strand | 148 | 1 | 8 |
| β-strand | 153-157 | 4 | 10 |
| β-strand | 171-173 | 3 | 9 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-178 | 2 | 9 |
| β-strand | 185-194 | 10 | 9 |
| β-strand | 205-212 | 7 | 10 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-223 | 7 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-14 | 5 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 44-49 | 6 | 2 |
| β-strand | 53-54 | 2 | 2 |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-107 | 6 | 2 |
| β-strand | 111 | 1 | 3 |
| β-strand | 114-118 | 5 | 4 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 4 |
| β-strand | 140 | 1 | 3 |
| β-strand | 146-150 | 5 | 5 |
| β-strand | 155 | 1 | 5 |
| β-strand | 159-163 | 5 | 4 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 4 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-196 | 6 | 5 |
| α-helix | 204 | 1 | |
| β-strand | 205-210 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| IgG FAB (IGG3, kappa) | L | protein | 219 | Mus musculus | |
| IgG FAB (IGG3, kappa) | H | protein | 218 | Mus musculus | P03987 (AlphaFold model) |
>1CLZ_1 IGG FAB (IGG3, KAPPA) (chains L) DVLMTQIPVSLPVSLGDQASISCRSSQIIVHNNGNTYLEWYLQKPGQSPQLLIYKVSNRF SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1CLZ_2 IGG FAB (IGG3, KAPPA) (chains H) EVNLVESGGGLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDY PDTVKGRFTISRDNAKNSLYLQMSRLKSEDTAMYYCARGLDDGAWFAYWGQGTLVTVSVT TTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFY SLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| NON | Methyl nonanoate (ESTER) | C10 H20 O2 | 1 |
The x-ray structure of an anti-tumour antibody in complex with antigen. Jeffrey, P.D., Bajorath, J., Chang, C.Y. et al. Nat Struct Biol (1995) 2:466-471. DOI 10.1038/nsb0695-466 · PubMed
Other PDB entries of the same protein (UniProt P03987 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1CLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.