1CNT: Ciliary neurotrophic factor

Ciliary neurotrophic factor. Determined by X-ray diffraction at 2.4 Å resolution. Released 26 Mar 1997.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,756
Mol. weight: 86.5 kDa
Ligands: YB
Released: 26 Mar 1997

Explore 1CNT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CNT contains 20 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	13-41	29
α-helix	69-93	25
α-helix	94-98	5
α-helix	104-129	26
α-helix	134-137	4
α-helix	152-180	29

Chain 2: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	13-42	30
α-helix	69-90	22
α-helix	103-129	27
α-helix	132-136	5
α-helix	153-180	28

Chain 3: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	17-42	26
α-helix	69-93	25
α-helix	94-98	5
α-helix	103-129	27
α-helix	151-181	31

Chain 4: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	13-40	28
α-helix	69-94	26
α-helix	103-129	27
α-helix	155-179	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ciliary neurotrophic factor	1, 2, 3, 4	protein	187	Homo sapiens	P26441 (AlphaFold model)

Sequence of entity 1 (1, 2, 3, 4), FASTA

>1CNT_1 CILIARY NEUROTROPHIC FACTOR (chains 1, 2, 3, 4)
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVAS
TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFA
YQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFIS
SHQTGIP

Ligands and cofactors

ID	Name	Formula	Copies
YB	Ytterbium (III) ion	Yb	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal structure of dimeric human ciliary neurotrophic factor determined by MAD phasing. McDonald, N.Q., Panayotatos, N., Hendrickson, W.A. EMBO J (1995) 14:2689-2699. PubMed

Other PDB entries of the same protein (UniProt P26441 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8D74 3.03 Å, Cryo-EM structure of human CNTF signaling complex: model containing the interaction core…

Browse structure collections

About this viewer

MolViewer shows 1CNT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.