1CO7: R117H mutant rat anionic trypsin

R117H mutant rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (BPTI). Determined by X-ray diffraction at 1.9 Å resolution. Released 7 Jan 2003.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Rattus norvegicus, Bos taurus
Chains: 2
Atoms: 2,099
Mol. weight: 36.92 kDa
Ligands: CA
Released: 7 Jan 2003

Explore 1CO7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CO7 contains 9 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-34	5	3
β-strand	40-48	9	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	64-68	4	3
β-strand	72	1	4
β-strand	81-90	10	3
β-strand	104-108	5	3
β-strand	122	1	2
α-helix	123-124	2
α-helix	128-130	3
β-strand	135-140	6	2
β-strand	154	1	4
β-strand	156-162	7	2
α-helix	163-164	2
α-helix	165-171	7
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-201	4	2
β-strand	204-215	8	2
β-strand	221A	1	5
β-strand	224	1	5
β-strand	226-230	5	2
α-helix	231-233	3
α-helix	235-244	10

Chain I: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	14	1	2
β-strand	18-23	6	6
β-strand	30-35	6	6
β-strand	45	1	6
α-helix	48-52	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trypsin II	E	protein	245	Rattus norvegicus	P00763 (AlphaFold model)
Bovine pancreatic trypsin inhibitor	I	protein	99	Bos taurus	P00974 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>1CO7_1 TRYPSIN II (chains E)
RALLFLALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSA
AHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNA
HVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITD
NMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQD
TIAAN

Sequence of entity 2 (I), FASTA

>1CO7_2 BOVINE PANCREATIC TRYPSIN INHIBITOR (chains I)
KMSRLCLSVALLVLLGTLAASTPGCDTSNQAKAQRPDFCLEPPYTGPCKARIIRYFYNAK
AGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGAIGPWENL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Other PDB entries of the same protein (UniProt P00763 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FP7 1.46 Å, Anionic trypsin variant S195A in complex with bovine pancreatic trypsin inhibitor (BPTI)…
3FP8 1.46 Å, Anionic trypsin variant S195A in complex with bovine pancreatic trypsin inhibitor (BPTI)…
3FP6 1.49 Å, Anionic trypsin in complex with bovine pancreatic trypsin inhibitor (BPTI) determined to…
1F7Z 1.55 Å, Rat trypsinogen K15A complexed with bovine pancreatic trypsin inhibitor
1DPO 1.59 Å, Structure of rat trypsin
1J16 1.6 Å, Benzamidine in complex with rat trypsin mutant X99/175/190RT
1F5R 1.65 Å, Rat trypsinogen mutant complexed with bovine pancreatic trypsin inhibitor
1FY8 1.7 Å, Crystal structure of the DELTAILE16VAL17 rat anionic trypsinogen-bpti complex
1YKT 1.7 Å, Trypsin/Bpti complex mutant
1YLC 1.7 Å, Trypsin/BPTI complex mutant
1YLD 1.7 Å, Trypsin/BPTI complex mutant
3TGK 1.7 Å, Trypsinogen mutant D194N and deletion of ile 16-val 17 complexed with bovine pancreatic…

Browse structure collections

About this viewer

MolViewer shows 1CO7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.