1CRZ: E. Coli tolb protein

Crystal structure of the E. Coli tolb protein. Determined by X-ray diffraction at 1.95 Å resolution. Released 16 Aug 2000.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Escherichia coli
Chains: 1
Atoms: 3,488
Mol. weight: 43.21 kDa
Released: 16 Aug 2000

Explore 1CRZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CRZ contains 9 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	14-16	3	1
β-strand	17-18	2	2
α-helix	19-21	3
β-strand	22-23	2	2
α-helix	33-43	11
β-strand	47-49	3	1
α-helix	50-51	2
α-helix	52-54	3
α-helix	67-71	5
β-strand	77-85	9	2
β-strand	91-99	9	2
β-strand	107-115	9	2
α-helix	117-119	3
α-helix	120-136	17
α-helix	139-140	2
β-strand	145-151	7	3
β-strand	159-165	7	3
β-strand	172-177	6	3
β-strand	181-186	6	4
β-strand	192-197	6	4
β-strand	204-209	6	4
β-strand	215-219	5	4
β-strand	229-230	2	5
β-strand	236-241	6	5
β-strand	248-253	6	5
β-strand	259-261	3	5
β-strand	269-274	6	6
β-strand	280-285	6	6
β-strand	292-297	6	6
β-strand	304-305	2	6
β-strand	312-318	7	7
β-strand	324-331	8	7
β-strand	334-341	8	7
β-strand	347-349	3	7
β-strand	357-361	5	8
β-strand	367-374	8	8
β-strand	377-384	8	8
β-strand	390-392	3	8
α-helix	393-395	3
β-strand	399-405	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tolb protein	A	protein	403	Escherichia coli	P0A855 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CRZ_1 TOLB PROTEIN (chains A)
DSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQ
PAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHT
ASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAW
SPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGS
LNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRI
TWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGT
MVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL

Primary citation

Structure of the Escherichia coli TolB protein determined by MAD methods at 1.95 A resolution. Abergel, C., Bouveret, E., Claverie, J.M. et al. Structure (1999) 7:1291-1300. DOI 10.1016/S0969-2126(00)80062-3 · PubMed

Other PDB entries of the same protein (UniProt P0A855 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HQS 1.5 Å, Crystal structure of TolB/Pal complex
2W8B 1.86 Å, Crystal structure of processed TolB in complex with Pal
1C5K 2.0 Å, The structure of tolb, an essential component of the tol-dependent translocation system…
2IVZ 2.0 Å, Structure of TolB in complex with a peptide of the colicin E9 T- domain
4JML 2.0 Å, Crystal structure of the TolB(P201C)-ColicinE9 TBE peptide(A33C) complex.
3IAX 2.6 Å, The crystal structure of the TolB box of Colicin A in complex with TolB reveals…
7NST 3.7 Å, ColicinE9 partial translocation complex
7NSU 4.7 Å, ColicinE9 intact translocation complex
9A2L Model of E. coli TolB by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 1CRZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.