1CZT: C2 domain of human coagulation factor V

Crystal structure of the C2 domain of human coagulation factor V. Determined by X-ray diffraction at 1.87 Å resolution. Released 26 Nov 1999.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,401
Mol. weight: 18.61 kDa
Released: 26 Nov 1999

Explore 1CZT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CZT contains 3 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
α-helix	14-16	3
β-strand	17-19	3	1
β-strand	24	1	2
β-strand	30	1	2
α-helix	33-35	3
β-strand	37	1	1
β-strand	47-48	2	3
β-strand	58-74	17	1
β-strand	76-78	3	4
β-strand	81-83	3	4
β-strand	84-93	10	1
β-strand	100-101	2	1
α-helix	110-112	3
β-strand	113-114	2	1
β-strand	123-144	22	1
β-strand	148-149	2	3
β-strand	150-157	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (coagulation factor V)	A	protein	160	Homo sapiens	P12259 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CZT_1 PROTEIN (COAGULATION FACTOR V) (chains A)
GCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLE
IDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQGVEWKPYRLKSSMVDKIFEGNTNT
KGHVKNFFNPPIISRFIRVIPKTWNQSITLRLELFGCDIY

Primary citation

Crystal structures of the membrane-binding C2 domain of human coagulation factor V. Macedo-Ribeiro, S., Bode, W., Huber, R. et al. Nature (1999) 402:434-439. DOI 10.1038/46594 · PubMed

Other PDB entries of the same protein (UniProt P12259 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9I24 1.2 Å, Coagulation factor Xa complex with a2-loop peptide
3P6Z 1.7 Å, Structural basis of thrombin mediated factor V activation: essential role of the…
3S9C 1.8 Å, Russell's viper venom serine proteinase, RVV-V in complex with the fragment (residues…
1CZS 1.9 Å, Crystal structure of the C2 domain of human coagulation factor V: complex with…
1CZV 2.4 Å, Crystal structure of the C2 domain of human coagulation factor V: dimeric crystal form
3P70 2.55 Å, Structural basis of thrombin-mediated factor V activation: essential role of the…
9T00 2.8 Å, Crystal structure of prethrombin-2 with a peptide corresponding to the C-terminus of the…
36JB 2.9 Å, Coagulation factor V DTQQ, membrane-bound, on Ptd-choline : Ptd-serine 75:25 vesicles
9MOV 3.0 Å, Cryo-EM structure of factor Va bound to activated protein C
8TN9 3.05 Å, Structural architecture of the acidic region of the B domain of coagulation factor V
9TLE 3.1 Å, Structure of human prothrombinase with prothrombin
9TLG 3.1 Å, Structure of human prothrombinase with meizothrombin

Browse structure collections

About this viewer

MolViewer shows 1CZT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.