Crystal structure of the C2 domain of human coagulation factor V. Determined by X-ray diffraction at 1.87 Å resolution. Released 26 Nov 1999.
Explore 1CZT in 3D Show helices and sheets RCSB PDB PDBe
1CZT contains 3 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-4 | 2 | 1 |
| α-helix | 14-16 | 3 | |
| β-strand | 17-19 | 3 | 1 |
| β-strand | 24 | 1 | 2 |
| β-strand | 30 | 1 | 2 |
| α-helix | 33-35 | 3 | |
| β-strand | 37 | 1 | 1 |
| β-strand | 47-48 | 2 | 3 |
| β-strand | 58-74 | 17 | 1 |
| β-strand | 76-78 | 3 | 4 |
| β-strand | 81-83 | 3 | 4 |
| β-strand | 84-93 | 10 | 1 |
| β-strand | 100-101 | 2 | 1 |
| α-helix | 110-112 | 3 | |
| β-strand | 113-114 | 2 | 1 |
| β-strand | 123-144 | 22 | 1 |
| β-strand | 148-149 | 2 | 3 |
| β-strand | 150-157 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (coagulation factor V) | A | protein | 160 | Homo sapiens | P12259 (AlphaFold model) |
>1CZT_1 PROTEIN (COAGULATION FACTOR V) (chains A) GCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLE IDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQGVEWKPYRLKSSMVDKIFEGNTNT KGHVKNFFNPPIISRFIRVIPKTWNQSITLRLELFGCDIY
Crystal structures of the membrane-binding C2 domain of human coagulation factor V. Macedo-Ribeiro, S., Bode, W., Huber, R. et al. Nature (1999) 402:434-439. DOI 10.1038/46594 · PubMed
Other PDB entries of the same protein (UniProt P12259 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1CZT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.