Domain III of pseudomonas aeruginosa exotoxin complexed with nicotinamide and AMP. Determined by X-ray diffraction at 2.5 Å resolution. Released 15 Sept 1995.
Explore 1DMA in 3D Show helices and sheets RCSB PDB PDBe
1DMA contains 25 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 408-410 | 3 | 1 |
| β-strand | 413-415 | 3 | 1 |
| α-helix | 419-431 | 13 | |
| β-strand | 434-443 | 10 | 2 |
| α-helix | 444-451 | 8 | |
| β-strand | 469-472 | 4 | 2 |
| α-helix | 475-478 | 4 | |
| α-helix | 479-481 | 3 | |
| β-strand | 483 | 1 | 3 |
| β-strand | 495 | 1 | 3 |
| β-strand | 496-504 | 9 | 2 |
| α-helix | 505-510 | 6 | |
| β-strand | 511-513 | 3 | 2 |
| α-helix | 523-531 | 9 | |
| α-helix | 537 | 1 | |
| β-strand | 541-545 | 5 | 2 |
| α-helix | 546 | 1 | |
| β-strand | 552-556 | 5 | 2 |
| α-helix | 558-561 | 4 | |
| β-strand | 565-568 | 4 | 2 |
| α-helix | 571-574 | 4 | |
| α-helix | 580-583 | 4 | |
| α-helix | 584-586 | 3 | |
| α-helix | 589-592 | 4 | |
| α-helix | 598-600 | 3 | |
| β-strand | 601 | 1 | 2 |
| α-helix | 604-608 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 408 | 1 | 4 |
| β-strand | 415 | 1 | 4 |
| α-helix | 419-430 | 12 | |
| β-strand | 434-443 | 10 | 5 |
| α-helix | 444-453 | 10 | |
| β-strand | 469-471 | 3 | 6 |
| β-strand | 472 | 1 | 5 |
| α-helix | 475-478 | 4 | |
| β-strand | 496-504 | 9 | 5 |
| α-helix | 508-510 | 3 | |
| β-strand | 511-513 | 3 | 6 |
| α-helix | 517 | 1 | |
| α-helix | 521-531 | 11 | |
| α-helix | 537 | 1 | |
| β-strand | 541-544 | 4 | 6 |
| β-strand | 553-556 | 4 | 6 |
| α-helix | 558-561 | 4 | |
| β-strand | 565-568 | 4 | 5 |
| β-strand | 574 | 1 | 7 |
| β-strand | 577 | 1 | 7 |
| α-helix | 584-586 | 3 | |
| α-helix | 589-594 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Exotoxin a | A, B | protein | 214 | Pseudomonas aeruginosa | P11439 (AlphaFold model) |
>1DMA_1 EXOTOXIN A (chains A, B) FLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARS QDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLA APEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPLAERTVVIPSAIPTDPRNVG GDLDPSSIPDKEQAISALPDYASQPGKPPREDLK
The crystal structure of Pseudomonas aeruginosa exotoxin domain III with nicotinamide and AMP: conformational differences with the intact exotoxin. Li, M., Dyda, F., Benhar, I. et al. Proc Natl Acad Sci U S A (1995) 92:9308-9312. DOI 10.1073/pnas.92.20.9308 · PubMed
Other PDB entries of the same protein (UniProt P11439 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1DMA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.