1DTP: Isolated catalytic domain of diphtheria toxin

Name: PDB 1DTP: The structure of the isolated catalytic domain of diphtheria toxin
Published: 1994-11-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

The structure of the isolated catalytic domain of diphtheria toxin. Determined by X-ray diffraction at 2.5 Å resolution. Released 1 Nov 1994.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Corynephage beta
Chains: 1
Atoms: 1,505
Mol. weight: 21.43 kDa
Ligands: APU
Released: 1 Nov 1994

Explore 1DTP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DTP contains 11 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	6	1	1
α-helix	8-10	3
β-strand	12-15	4	2
β-strand	18-23	6	2
α-helix	28-33	6
α-helix	48-50	3
β-strand	53-56	4	2
α-helix	59-63	5
β-strand	79-84	6	2
β-strand	88-93	6	2
β-strand	94	1	1
α-helix	99-106	8
α-helix	114-117	4
α-helix	121-127	7
β-strand	133-139	7	2
β-strand	147-151	5	2
β-strand	160-165	6	2
α-helix	167-173	7
α-helix	174-182	9
α-helix	185-187	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Diphtheria toxin	A	protein	190	Corynephage beta	P00588

Sequence of entity 1 (A), FASTA

>1DTP_1 DIPHTHERIA TOXIN (chains A)
GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKY
DAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGT
EEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYE
YMAQACAGNR

Ligands and cofactors

ID	Name	Formula	Copies
APU	Adenylyl-3'-5'-phospho-uridine-3'-monophosphate	C19 H25 N7 O15 P2	1

Primary citation

Structure of the isolated catalytic domain of diphtheria toxin. Weiss, M.S., Blanke, S.R., Collier, R.J. et al. Biochemistry (1995) 34:773-781. DOI 10.1021/bi00003a010 · PubMed

Other PDB entries of the same protein (UniProt P00588), best resolution first:

1F0L 1.55 Å, 1.55 Å crystal structure of wild type diphtheria toxin
4AE0 2.0 Å, Crystal structure of diphtheria toxin mutant CRM197
1DDT 2.0 Å, The refined structure of dimeric diphtheria toxin at 2.0 Å resolution
4AE1 2.08 Å, Crystal structure of diphtheria toxin mutant CRM197 in complex with nicotinamide
1MDT 2.3 Å, The refined structure of monomeric diphtheria toxin at 2.3 Å resolution
1SGK 2.3 Å, Nucleotide-free diphtheria toxin
1TOX 2.3 Å, Diphtheria toxin dimer complexed with NAD
1XDT 2.65 Å, Complex of diphtheria toxin and heparin-binding epidermal growth factor
4OW6 2.8 Å, Crystal structure of Diphtheria Toxin at acidic pH

Browse structure collections

About this viewer

MolViewer shows 1DTP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.