1DUL: Signal recognition particle protein

Structure of the ribonucleoprotein core of the E. Coli signal recognition particle. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Feb 2000.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: synthetic construct, Escherichia coli
Chains: 2
Atoms: 1,892
Mol. weight: 28.84 kDa
Ligands: MG
Released: 28 Feb 2000

Explore 1DUL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DUL contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-8	6
α-helix	24-33	10
α-helix	37-41	5
α-helix	43-45	3
α-helix	48-57	10
α-helix	62-81	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4.5 S RNA domain IV	B	RNA	49	synthetic construct
Signal recognition particle protein	A	protein	105	Escherichia coli	P0AGD7 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1DUL_1 4.5 S RNA DOMAIN IV (chains B)
GGCUCUGUUUACCAGGUCAGGUCCGAAAGGAAGCAGCCAAGGCAGAGCC

Sequence of entity 2 (A), FASTA

>1DUL_2 Signal recognition particle protein (chains A)
GFDLNDFLEQLRQMKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKE
RAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKMKK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4

Water and common crystallization additives (K) are not listed.

Primary citation

Crystal structure of the ribonucleoprotein core of the signal recognition particle. Batey, R.T., Rambo, R.P., Lucast, L. et al. Science (2000) 287:1232-1239. DOI 10.1126/science.287.5456.1232 · PubMed

Other PDB entries of the same protein (UniProt P0AGD7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HQ1 1.52 Å, Structural and energetic analysis of RNA recognition by a universally conserved protein…
3LQX 1.93 Å, SRP ribonucleoprotein core complexed with cobalt hexammine
2PXD 2.0 Å, Variant 1 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXE 2.0 Å, Variant 4 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXF 2.0 Å, Variant 5 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXV 2.0 Å, Variant 6 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
7O9I 2.49 Å, Escherichia coli Ffh in complex with pppGpp
2PXB 2.5 Å, Variant 2 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXK 2.5 Å, Variant 8 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXL 2.5 Å, Variant 9 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXP 2.5 Å, Variant 13 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXQ 2.5 Å, Variant 14 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle

Browse structure collections

About this viewer

MolViewer shows 1DUL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.