L1 protein of human papillomavirus 16. Determined by X-ray diffraction at 3.5 Å resolution. Released 9 Mar 2000.
Explore 1DZL in 3D Show helices and sheets RCSB PDB PDBe
1DZL contains 22 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 24-26 | 3 | |
| α-helix | 28 | 1 | |
| β-strand | 29-38 | 10 | 1 |
| β-strand | 42-46 | 5 | 1 |
| β-strand | 47 | 1 | 2 |
| β-strand | 52-53 | 2 | 3 |
| β-strand | 60-62 | 3 | 3 |
| β-strand | 64 | 1 | 2 |
| β-strand | 69 | 1 | 4 |
| β-strand | 71-76 | 6 | 5 |
| β-strand | 96-109 | 14 | 1 |
| α-helix | 112 | 1 | |
| β-strand | 114 | 1 | 6 |
| β-strand | 118-123 | 6 | 7 |
| β-strand | 125-128 | 4 | 8 |
| β-strand | 145-149 | 5 | 7 |
| β-strand | 150 | 1 | 8 |
| α-helix | 151-152 | 2 | |
| β-strand | 153-160 | 8 | 5 |
| β-strand | 165-171 | 7 | 9 |
| α-helix | 184-187 | 4 | |
| β-strand | 188-194 | 7 | 9 |
| α-helix | 199 | 1 | |
| β-strand | 200-201 | 2 | 4 |
| α-helix | 202 | 1 | |
| β-strand | 208 | 1 | 9 |
| α-helix | 210-213 | 4 | |
| α-helix | 222-225 | 4 | |
| β-strand | 229-230 | 2 | 4 |
| β-strand | 231-232 | 2 | 9 |
| α-helix | 234-239 | 6 | |
| β-strand | 248-254 | 7 | 5 |
| β-strand | 256-263 | 8 | 8 |
| α-helix | 264 | 1 | |
| α-helix | 270-272 | 3 | |
| α-helix | 273-275 | 3 | |
| α-helix | 286-288 | 3 | |
| β-strand | 291-296 | 6 | 8 |
| β-strand | 310-312 | 3 | 1 |
| β-strand | 323-324 | 2 | 1 |
| α-helix | 325-327 | 3 | |
| β-strand | 330-335 | 6 | 5 |
| β-strand | 338 | 1 | 6 |
| β-strand | 342-347 | 6 | 10 |
| α-helix | 357-359 | 3 | |
| β-strand | 360-365 | 6 | 10 |
| β-strand | 366-382 | 17 | 1 |
| α-helix | 385-394 | 10 | |
| α-helix | 397-401 | 5 | |
| α-helix | 408-409 | 2 | |
| α-helix | 414-425 | 12 | |
| β-strand | 447-450 | 4 | 5 |
| β-strand | 456 | 1 | 1 |
| α-helix | 459-461 | 3 | |
| α-helix | 463-472 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Late major capsid protein L1 | A | protein | 505 | HUMAN PAPILLOMAVIRUS TYPE 16 | P03101 (AlphaFold model) |
>1DZL_1 LATE MAJOR CAPSID PROTEIN L1 (chains A) MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNNKI LVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGVGISGH PLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKGSPCTQVAV QPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDICTSICKYPDYIKMVSE PYGDSLFFYLRREQMFVRHLFNRAGTVGENVPDDLYIKGSGSTANLASSNYFPTPSGSMV TSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTNMSLCAAISTSETTYKNTNF KEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILEDWNFGLQPPPGGTLEDTYRF VTSQAIACQKHTPPAPKEDPLKKYTFWEVNLKEKFSADLDQFPLGRKFLLQLGLKAKPKF TLGKRKATPTTSSTSTTAKRKKRKL
Structure of Small Virus-Like Particles Assembled from the L1 Protein of Human Papillomavirus 16. Chen, X.J., Garcea, B., Goldberg, I. et al. Mol Cell (2000) 5:557. DOI 10.1016/S1097-2765(00)80449-9 · PubMed
Other PDB entries of the same protein (UniProt P03101 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1DZL is part of these collections:
MolViewer shows 1DZL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.