1E0S: Small G protein Arf6-GDP

Name: PDB 1E0S: small G protein Arf6-GDP
Published: 2000-04-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: g protein

small G protein Arf6-GDP. Determined by X-ray diffraction at 2.28 Å resolution. Released 18 Apr 2000.

Method: X-ray diffraction
Resolution: 2.28 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,522
Mol. weight: 20.52 kDa
Ligands: GDP
Released: 18 Apr 2000

Explore 1E0S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1E0S contains 12 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	3-9	7
β-strand	14-21	8	1
α-helix	26-32	7
β-strand	39-44	6	1
β-strand	47-54	8	1
β-strand	57-64	8	1
α-helix	68-70	3
α-helix	71-74	4
α-helix	75-77	3
β-strand	83-89	7	1
α-helix	93-95	3
α-helix	96-107	12
α-helix	110-112	3
β-strand	116-122	7	1
α-helix	129-131	3
α-helix	132-138	7
α-helix	141-143	3
β-strand	149-153	5	1
β-strand	155	1	2
β-strand	160	1	2
α-helix	162-172	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor 6	A	protein	174	Homo sapiens	P62330 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1E0S_1 ADP-ribosylation factor 6 (chains A)
GKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNV
WDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFA
NKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Water and common crystallization additives (NH4, BME) are not listed.

Primary citation

Structure of Arf6-Gdp Suggests a Basis for Guanine Nucleotide Exchange Factors Specificity. Menetrey, J., Macia, E., Pasqualato, S. et al. Nat Struct Biol (2000) 7:466. DOI 10.1038/75863 · PubMed

Other PDB entries of the same protein (UniProt P62330 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A5D 1.8 Å, Structural basis for the activation of cholera toxin by human ARF6-GTP
3N5C 1.82 Å, Crystal Structure of Arf6DELTA13 complexed with GDP
4KAX 1.85 Å, Crystal structure of the Grp1 PH domain in complex with Arf6-GTP
2W83 1.93 Å, Crystal structure of the ARF6 GTPase in complex with a specific effector, JIP4
6PAU 1.93 Å, Structure of Human NMT2 with myristoyl-lysine peptide and CoA products
2A5F 2.02 Å, Cholera toxin A1 subunit bound to its substrate, NAD+, and its human protein activator,…
7RK3 2.05 Å, Crystal structure of human N-myristoyltransferase 1 fragment (residues 109-496) bound to…
3PCR 2.5 Å, Structure of EspG-Arf6 complex
6PAV 2.52 Å, Structure of Human NMT1 with products CoA and myristoyl-lysine peptide with acetylated…
2A5G 2.66 Å, Cholera toxin A1 subunit bound to ARF6(Q67L)
2J5X 2.8 Å, Structure of the small G protein ARF6 in complex with gtpgammas
3LVQ 3.38 Å, The crystal structure of ASAP3 in complex with Arf6 in transition state

Browse structure collections

About this viewer

MolViewer shows 1E0S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.