1E3K: Human Progesteron Receptor Ligand Binding Domain

Human Progesteron Receptor Ligand Binding Domain in complex with the ligand metribolone (R1881). Determined by X-ray diffraction at 2.8 Å resolution. Released 14 Jun 2001.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 4,070
Mol. weight: 60.05 kDa
Ligands: R18
Released: 14 Jun 2001

Explore 1E3K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1E3K contains 27 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	686-694	9
α-helix	696-698	3
α-helix	711-734	24
α-helix	739-741	3
α-helix	744-770	27
β-strand	776-779	4	1
β-strand	782-784	3	1
α-helix	795-801	7
α-helix	803-811	9
α-helix	815-826	12
β-strand	829-830	2	2
α-helix	838-856	19
α-helix	865-896	32
α-helix	898-901	4
α-helix	907-921	15
β-strand	926-927	2	2
α-helix	928-929	2

Chain B: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	686-694	9
α-helix	696-698	3
α-helix	711-735	25
α-helix	739-741	3
α-helix	744-770	27
β-strand	776-779	4	3
β-strand	782-784	3	3
α-helix	786-790	5
α-helix	795-801	7
α-helix	803-811	9
α-helix	815-826	12
β-strand	829-830	2	4
α-helix	838-856	19
α-helix	865-896	32
α-helix	898-901	4
α-helix	907-921	15
β-strand	926-927	2	4
α-helix	928	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Progesterone receptor	A, B	protein	258	HOMO SAPIENS	P06401 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1E3K_1 PROGESTERONE RECEPTOR (chains A, B)
SPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKS
LPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFY
SLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKA
IGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAA
QLPKILAGMVKPLLFHKK

Ligands and cofactors

ID	Name	Formula	Copies
R18	(17BETA)-17-hydroxy-17-methylestra-4,9,11-trien-3-one	C19 H24 O2	2

Primary citation

Structural evidence for ligand specificity in the binding domain of the human androgen receptor. Implications for pathogenic gene mutations. Matias, P.M., Donner, P., Coelho, R. et al. J Biol Chem (2000) 275:26164-26171. DOI 10.1074/jbc.M004571200 · PubMed

Other PDB entries of the same protein (UniProt P06401 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SQN 1.45 Å, Progesterone Receptor Ligand Binding Domain with bound Norethindrone
1SR7 1.46 Å, Progesterone Receptor Hormone Binding Domain with Bound Mometasone Furoate
3ZR7 1.65 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
1A28 1.8 Å, Hormone-bound human progesterone receptor ligand-binding domain
2W8Y 1.8 Å, RU486 bound to the progesterone receptor in a destabilized agonistic conformation
3ZRB 1.8 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
3G8O 1.9 Å, Progesterone Receptor with bound Pyrrolidine 1
3ZRA 1.9 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
4APU 1.9 Å, PR X-Ray structures in agonist conformations reveal two different mechanisms for partial…
1ZUC 2.0 Å, Progesterone receptor ligand binding domain in complex with the nonsteroidal agonist…
2OVH 2.0 Å, Progesterone Receptor with Bound Asoprisnil and a Peptide from the Co-Repressor SMRT
3KBA 2.0 Å, Progesterone receptor bound to sulfonamide pyrrolidine partial agonist

Browse structure collections

About this viewer

MolViewer shows 1E3K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.