Structure of erythrocruorin in different ligand states refined at 1.4 Å resolution. Determined by X-ray diffraction at 1.4 Å resolution. Released 5 Jul 1979.
Explore 1ECA in 3D Show helices and sheets RCSB PDB PDBe
1ECA contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-14 | 12 | |
| α-helix | 20-30 | 11 | |
| α-helix | 32-35 | 4 | |
| α-helix | 46-49 | 4 | |
| α-helix | 53-71 | 19 | |
| α-helix | 77-87 | 11 | |
| α-helix | 88-90 | 3 | |
| α-helix | 94-111 | 18 | |
| α-helix | 114-117 | 4 | |
| α-helix | 118-135 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Erythrocruorin (aquo met) | A | protein | 136 | Chironomus thummi thummi | P02229 (AlphaFold model) |
>1ECA_1 ERYTHROCRUORIN (AQUO MET) (chains A) LSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAGKDLESIKGTAPFETHAN RIVGFFSKIIGELPNIEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAA WGATLDTFFGMIFSKM
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
Structure of erythrocruorin in different ligand states refined at 1.4 A resolution. Steigemann, W., Weber, E. J Mol Biol (1979) 127:309-338. DOI 10.1016/0022-2836(79)90332-2 · PubMed
Other PDB entries of the same protein (UniProt P02229 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1ECA is part of these collections:
MolViewer shows 1ECA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.