1EDM: Factor IX

Epidermal growth factor-like domain from human factor IX. Determined by X-ray diffraction at 1.5 Å resolution. Released 14 Oct 1996.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 777
Mol. weight: 8.68 kDa
Ligands: CA
Released: 14 Oct 1996

Explore 1EDM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EDM contains 2 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	1
β-strand	68-72	5	1

Chain C: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	60	1
β-strand	61-64	4	2
β-strand	69-72	4	2
α-helix	73-74	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Factor IX	B, C	protein	39	Homo sapiens	P00740 (AlphaFold model)

Sequence of entity 1 (B, C), FASTA

>1EDM_1 FACTOR IX (chains B, C)
VDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCEL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Primary citation

The structure of a Ca(2+)-binding epidermal growth factor-like domain: its role in protein-protein interactions. Rao, Z., Handford, P., Mayhew, M. et al. Cell (1995) 82:131-141. DOI 10.1016/0092-8674(95)90059-4 · PubMed

Other PDB entries of the same protein (UniProt P00740 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JB9 1.3 Å, Crystal structure of factor IXa K98T variant in complex with PPACK
6MV4 1.37 Å, Crystal structure of human coagulation factor ixa
5JBA 1.4 Å, Crystal structure of factor IXa variant V16I K98T Y177T I212V in complex with PPACK
5TNT 1.4 Å, Discovery of novel aminobenzisoxazole derivatives as orally available factor IXa…
4YZU 1.41 Å, Rapid development of two Factor IXa inhibitors from Hit to Lead
4Z0K 1.41 Å, Rapid development of two Factor IXa inhibitors from Hit to Lead
5JB8 1.45 Å, Crystal structure of factor IXa variant K98T in complex with EGR-chloromethylketone
2WPH 1.5 Å, factor IXa superactive triple mutant
5TNO 1.54 Å, Discovery of novel aminobenzisoxazole derivatives as orally available factor IXa…
5JBB 1.56 Å, Crystal structure of factor IXa variant V16I K98T Y177T I213V in complex with…
2WPJ 1.6 Å, factor IXa superactive triple mutant, NaCl-soaked
6RFK 1.6 Å, Crystal structure of EGRCK-inhibited Gla-domainless fIXa (K148Q, R150Q variant)

Browse structure collections

About this viewer

MolViewer shows 1EDM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.