1EJ1: Eukaryotic translation initiation factor 4E

Name: PDB 1EJ1: Cocrystal structure of the messenger RNA 5' cap-binding protein (EIF4E) bound to 7-methyl-GDP
Published: 2000-03-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Cocrystal structure of the messenger RNA 5' cap-binding protein (EIF4E) bound to 7-methyl-GDP. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Mar 2000.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,188
Mol. weight: 45.21 kDa
Ligands: M7G
Released: 15 Mar 2000

Explore 1EJ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EJ1 contains 23 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	38-48	11	1
α-helix	56-59	4
β-strand	60-68	9	1
α-helix	69-76	8
α-helix	82-84	3
α-helix	86	1
β-strand	90-95	6	1
α-helix	105-108	4
β-strand	111-116	6	1
α-helix	117-118	2
α-helix	119-121	3
α-helix	122-126	5
α-helix	127-138	12
α-helix	143-148	6
β-strand	149-155	7	1
β-strand	162-167	6	1
α-helix	173-187	15
β-strand	196-199	4	1
α-helix	200-204	5
β-strand	213-216	4	1

Chain B: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	31-34	4
α-helix	35-37	3
β-strand	38-48	11	2
α-helix	57-59	3
β-strand	60-68	9	2
α-helix	69-77	9
α-helix	82-84	3
α-helix	86	1
β-strand	90-95	6	2
β-strand	111-116	6	2
α-helix	121-124	4
α-helix	126-138	13
α-helix	143-148	6
β-strand	149-155	7	2
β-strand	162-167	6	2
α-helix	173-187	15
β-strand	196-199	4	2
α-helix	200-204	5
β-strand	215-216	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 4E	A, B	protein	190	Mus musculus	P63073 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1EJ1_1 EUKARYOTIC TRANSLATION INITIATION FACTOR 4E (chains A, B)
VANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMP
GCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSD
DVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKS
GSTTKNRFVV

Ligands and cofactors

ID	Name	Formula	Copies
M7G	7N-methyl-8-hydroguanosine-5'-diphosphate	C11 H18 N5 O11 P2	2

Primary citation

Cocrystal structure of the messenger RNA 5' cap-binding protein (eIF4E) bound to 7-methyl-GDP. Marcotrigiano, J., Gingras, A.C., Sonenberg, N. et al. Cell (1997) 89:951-961. DOI 10.1016/S0092-8674(00)80280-9 · PubMed

Other PDB entries of the same protein (UniProt P63073 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M7X 1.68 Å, Translation initiation factor 4E in complex with (RP)-m2(7,2'O)GppSepG mRNA 5' cap…
5M7Z 1.69 Å, Translation initiation factor 4E in complex with (SP)-m2(7,2'O)GppSepG mRNA 5' cap…
5M7V 1.74 Å, Translation initiation factor 4E in complex with (RP)-m2(7,2'O)GppSpG mRNA 5' cap analog…
5J5Y 1.75 Å, Translation initiation factor 4E in complex with m2(7,2'O)GppCCl2ppG mRNA 5' cap analog
6U09 1.79 Å, Discovery of Lysine-Targeted eIF4E Inhibitors through Covalent Docking
1L8B 1.8 Å, Cocrystal Structure of the Messenger RNA 5' Cap-binding Protein (eIF4E) bound to…
5M84 1.85 Å, Translation initiation factor 4E in complex with (SP)-m2(7,2'O)GppSpA mRNA 5' cap analog
6GKK 1.86 Å, Translation initiation factor 4E in complex with beta-phosphorothioate trinucleotide…
5M83 1.86 Å, Translation initiation factor 4E in complex with (RP)-m2(7,2'O)GppSpA mRNA 5' cap analog
5J5O 1.87 Å, Translation initiation factor 4E in complex with m7GppppG mRNA 5' cap analog
5M81 1.9 Å, Translation initiation factor 4E in complex with (SP)-iPr-m7GppSpG mRNA 5' cap analog
5OSX 1.92 Å, Translation initiation factor 4E in complex with m7G(5'S)ppp(5'S)G mRNA 5' cap analog

Browse structure collections

About this viewer

MolViewer shows 1EJ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.